KEGG   Gramella forsetii: GFO_2250Help
Entry
GFO_2250          CDS       T00448                                 

Definition
lipoamide acyltransferase component of 2-oxoacid dehydrogenase complex (EC:2.3.1.-)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gfo  Gramella forsetii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GFO_2250
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GFO_2250
  Amino acid metabolism
   00310 Lysine degradation
    GFO_2250
Enzymes [BR:gfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GFO_2250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2392087..2393412)
Genome map
AA seq 441 aa AA seqDB search
MAKFELKLPKMGESVAEATITSWLKEVGDTIEMDEPVLEIATDKVDSEVPSEVDGKLVEK
LFNADDVVKVGQTIAIIETDGDAEGGTDEDEDEEPAQAADVAETVETAKTTASSSESTED
YSDSSRFYSPLVKNIAKEEGIALSELEGIDGTGKEGRVTKNDILGYVENRGSQSQKSEAS
KGKSIDTKDVEAGVSKKPEPVVSGEDEIIEMSRMGKMIAHHMVDSVQKSAHVQSFIEVDV
TNIWNWRNKHKADFQKKEGEKLTFTPIFMEAVAKAIRDFPMVNIAVNEDVTKVIKKKNIN
LGMAAALPDGNLIVPVIKNADRLNLVGMAKAVNDLANRARQNKLKPDDIQGGTYTVTNVG
TFGSIMGTPIINQPQVGILALGAIRKMPAVIETPDGDFIGIRYKMILSHSYDHRVVNGAL
GGQFVQRVAQYLEGFDKNREI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaattgaagttgcccaaaatgggtgaaagtgttgcagaagcaacgata
acaagctggctgaaggaagtaggggataccattgaaatggatgagccggttcttgaaata
gcaacagataaagttgatagcgaggttccaagtgaagttgacgggaaacttgtggagaaa
ctttttaatgccgatgacgttgttaaagtaggccagactattgcaatcatagaaactgat
ggtgatgctgaaggaggaacagatgaagatgaagacgaagaaccagcacaagcagccgat
gtagcagaaaccgtggaaacagcaaaaacaactgcatcatcttctgaatctactgaagat
tattcagattcttccagattttactctcctctggttaagaatattgctaaggaagaagga
atcgctttatcagaacttgaaggaattgacggaactggaaaagaaggtcgggttactaag
aatgacattcttggttatgttgaaaacagaggttcccagtctcagaaatctgaagcttcc
aaaggaaaatctatagatactaaagatgtagaggccggagtttctaaaaagccggaacct
gttgttagtggagaagatgaaattattgagatgagcagaatgggtaaaatgatcgcccat
catatggtagacagtgttcaaaaatctgcgcatgttcagtcttttattgaagttgatgta
actaatatctggaactggagaaataaacataaagccgattttcagaagaaggaaggtgag
aaacttacgtttacaccaatatttatggaagcggtagcaaaagcgattcgtgatttccca
atggtcaatattgcggtaaatgaggatgttaccaaagtgatcaagaagaaaaatattaac
ctgggaatggccgcagcccttcctgatggaaacttaattgtaccggtaatcaaaaatgca
gataggctaaaccttgttggaatggctaaagcggtaaatgatcttgccaatcgtgcaaga
cagaataaactgaagccagacgatatccagggaggaacttatacagttaccaatgtgggt
acttttggaagtatcatgggaactccaattatcaatcaacctcaggtaggtattcttgct
ttaggagccattagaaaaatgcctgctgtgattgaaacaccagacggtgattttattggg
attcgttacaagatgatcctttcgcatagttatgaccatagagtggtaaatggagctcta
ggaggacaatttgttcaaagagtggcacaatacctggaaggttttgataagaatagagaa
atataa

DBGET integrated database retrieval system