KEGG   Gramella forsetii: GFO_2251Help
Entry
GFO_2251          CDS       T00448                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gfo  Gramella forsetii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gfo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2393628..2394245)
Genome map
AA seq 205 aa AA seqDB search
MDFSSKLLEQAVDEMSQLPGIGKRTALRLVLHLLKQPEEQTTQLSKALLELRQNIKLCNN
CYNISDTELCEICANPSRVSEIVCVVEDIRDVMAIENTGQYRGHYHVLGGKISPMDGIGP
SQLTIKPLIEKVQAGKIDEIIFALSSTLEGDTTNFYIFKQLEGTAIKTSTIARGISVGDE
LEYADEVTLGRSITNRIPFENSMKS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggatttttcttcaaaattactggagcaggcagtggacgaaatgtcccagttgccggga
attggaaagcgaactgcgctaagactggtattacatcttttaaagcaaccggaggagcag
acaacccagctttcgaaagctcttttagagctaagacaaaatatcaaactctgtaataac
tgttacaatattagtgacaccgaactctgcgaaatttgtgcgaatccatctagagtttca
gaaattgtttgtgtagtagaagatattcgtgatgtaatggccattgaaaataccggtcag
tatagagggcattatcatgttttaggagggaagataagtcccatggatggtattggccct
tcacagctcactataaaacctttgatagaaaaagtacaggcaggaaagatcgacgagatt
atttttgctttaagcagtactctggaaggagatactaccaatttttatattttcaagcaa
ttggaaggtactgctattaaaacttcaaccattgcacgtggaatttcagtaggagatgaa
ctggaatacgccgatgaggtaactttagggcgaagtataaccaacagaattccttttgaa
aattccatgaagagctag

DBGET integrated database retrieval system