KEGG   Gramella forsetii: GFO_2545Help
Entry
GFO_2545          CDS       T00448                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
gfo  Gramella forsetii
Pathway
gfo00010  Glycolysis / Gluconeogenesis
gfo00520  Amino sugar and nucleotide sugar metabolism
gfo01100  Metabolic pathways
gfo01110  Biosynthesis of secondary metabolites
gfo01120  Microbial metabolism in diverse environments
gfo01130  Biosynthesis of antibiotics
gfo01200  Carbon metabolism
Module
gfo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GFO_2545 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    GFO_2545 (ppgK)
Enzymes [BR:gfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     GFO_2545 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: CAL67501
UniProt: A0M4F6
Position
2660480..2661226
Genome map
AA seq 248 aa AA seqDB search
MDILGIDIGGSSLKGAVVNMNTGKLKTSAHRIPTPESREPDGIALAVKEMITHFDYDGIV
GCGFPTIIKKGICNHEGNLSEKWVNVDVDTLFEKTTGLNFTVINDADAAGLAEIKFGAGR
DHEGFILMITVGTGLGSGAYLNGELIPNFELGQIPYKEYEKIEEWAASSVKTEKKLSYKE
WGSRFNVFLKYIHKILNPDMIIVGGGISNDWDKFENYLDPDVKLIPAELRNDSGILGAAL
AAYVKDSK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggacattttaggaatagatataggcggctcaagtcttaaaggcgccgtagtaaatatg
aacacgggaaagttaaaaacttcagcccatcgtattcccacaccagaatcccgtgaacca
gatggcattgccctcgcagtaaaagaaatgataacgcattttgattatgatggtatcgta
ggctgtggatttcccaccataatcaaaaaaggaatctgtaatcacgaaggcaatcttagt
gaaaagtgggttaatgtagatgttgatactctttttgaaaaaactacgggacttaatttt
acggtaattaacgatgccgatgccgccggacttgcagaaataaaatttggggctggaaga
gatcatgaaggttttattcttatgataaccgtaggaacaggtttgggtagcggagcttat
cttaacggggaactaattcctaattttgaacttggacagataccttataaggaatatgaa
aaaattgaggaatgggcagcttcttccgtaaagactgaaaaaaaattaagctataaagaa
tggggttcccgctttaatgtctttctaaagtatattcataaaattctaaacccggacatg
attattgtgggcggagggatctccaacgactgggacaaatttgaaaattatttagatcca
gatgtcaaactgattccggcagaacttagaaatgactcaggtattctgggagcagcattg
gcagcttacgtaaaagattctaaataa

DBGET integrated database retrieval system