KEGG   Gramella forsetii: GFO_2671Help
Entry
GFO_2671          CDS       T00448                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gfo  Gramella forsetii
Pathway
gfo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gfo01100  Metabolic pathways
gfo01110  Biosynthesis of secondary metabolites
gfo01130  Biosynthesis of antibiotics
gfo01230  Biosynthesis of amino acids
Module
gfo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GFO_2671 (trpC)
Enzymes [BR:gfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GFO_2671 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAL67627
UniProt: A0M4T2
Position
2788455..2789243
Genome map
AA seq 262 aa AA seqDB search
MNILDKIIADKFKEVELKKSLIPVSQLENSVLFDRKCISLAESLKNGSGIIAEHKRRSPS
KSVINQSLNVQDVVKGYEEAEVSGISVLTDGKYFGGSLEDLLYARASVNTPLLRKEFMVD
AYQVSEAKAYGADAILLIAAVLSEKQLIYLADSAKKLGMDVLLEIHNEEELQKSLNVNAD
MIGVNNRNLKTFEVSIDTSKRLAKLIPNEFVKVSESGISTTAAITDLKNYGFEGFLIGEN
FMKTDNPGAAAKEFITELKSMA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatattctcgataagataattgcagataaattcaaggaagtagaattaaaaaaatca
ttgattccggtttctcaacttgagaattctgtattatttgacagaaaatgtatttctctg
gctgaaagcttaaaaaatggttccggtattattgcggagcataaaaggagatcaccatca
aaatctgtgatcaatcaaagcctgaatgttcaggatgtcgtaaaaggatatgaagaagcc
gaggtttcaggaatttcagtacttacagacgggaaatattttggtggttcattagaagat
ttgctttatgcgcgagcttccgtaaatacgccacttcttcggaaggaatttatggtcgat
gcatatcaggtttccgaagcaaaagcctatggtgcagatgccattctattgattgctgcg
gttttatctgaaaaacaattgatctatcttgcagattccgcgaaaaaacttggaatggat
gttctattagaaattcataatgaagaagaattgcaaaaatctttaaatgtaaatgctgat
atgatcggagtaaataaccgaaacctaaagacttttgaagtgagtattgatacttcaaaa
aggctggcaaagcttattccaaatgaattcgttaaagtttcagaaagtggaattagtact
actgcggctattacagatcttaaaaattacggctttgaaggatttctgatcggtgaaaac
ttcatgaaaaccgataatcccggagctgcggcaaaagaatttattacagaattaaaatct
atggcataa

DBGET integrated database retrieval system