KEGG   Gramella forsetii: GFO_2673Help
Entry
GFO_2673          CDS       T00448                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gfo  Gramella forsetii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GFO_2673 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GFO_2673 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GFO_2673 (trpB)
Enzymes [BR:gfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GFO_2673 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2789959..2791140
Genome map
AA seq 393 aa AA seqDB search
MSYQVNENGYYGEFGGAYIPEMLYPNVEELRSRYLDIMQEESFQKEFKELLKEYVGRPTP
LYYAKRFSEKYGTKVYLKREDLCHTGAHKVNNTIGQILMAQKLGKKRIIAETGAGQHGVA
TATVCALMGMECIVYMGEIDIDRQAPNVARMKMLGAKVVPAKSGSRTLKDATNEAIRDWI
NNPVDTHYIIGSVVGPHPYPDMVARFQAVISEEIKNQLKEKEGKEEPDFVVACVGGGSNA
AGAYYHYLDNPDVGIIAVEAAGKGINSGESAATSALGKAGIIHGSKTLLMQTGDGQITEP
YSISAGLDYPGVGPMHANLFTSKRGEFISVTDEAAMKAGLELAKLEGIIPAIETSHALAI
FETRKFKEDDIVVVNLSGRGDKDLNTYIEYFNL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcaggttaatgaaaatggatattacggagaatttggcggcgcctatattccc
gaaatgttatatccaaatgtagaagaattgcgttcgcgttatttagatattatgcaggaa
gaatcctttcagaaggaatttaaggaacttttgaaggaatatgttggacgcccaactcct
ctttattatgcgaaacgatttagtgaaaaatacggcactaaagtatatttaaagagagaa
gatctttgtcatacaggagcgcacaaggtcaacaacactattggccagattctaatggcc
caaaaacttggcaagaagcgaattattgctgaaaccggagccggacaacatggtgtagct
acggcaacggtttgcgctcttatgggtatggaatgtatcgtctatatgggtgagatcgat
atagatcgccaggcgccaaatgtggcccggatgaaaatgctcggtgccaaagtggttccg
gcaaagtcgggaagccgcacccttaaggatgcaacgaacgaagctattagagactggatc
aacaatcctgtagatacgcattatattattggatctgtagtaggaccacatccttatccc
gatatggtggccaggtttcaggctgtaatttctgaggagattaaaaatcaattaaaggaa
aaagaaggtaaagaagagccagattttgttgtggcctgtgtaggtggcggaagtaatgct
gccggtgcttactatcattatcttgataatcctgatgttggaattattgctgtggaagct
gccggaaaaggaattaattcaggtgaaagtgcagcaacctcagcacttggaaaagctgga
attattcacggaagtaaaactttattgatgcaaaccggtgatggccagattaccgaacct
tattctatttctgccggactcgattatccgggagttggacctatgcatgccaatctattt
accagcaaaagaggtgaatttataagtgttactgatgaagctgccatgaaagccggtctg
gaactggcaaaattggaaggaattatccccgccattgaaacttctcatgcgctggcaatt
tttgaaaccagaaagttcaaggaagatgacattgtggtagtgaacctttcaggacgtgga
gataaagacctgaatacctatatcgaatattttaatttataa

DBGET integrated database retrieval system