KEGG   Gramella forsetii: GFO_2674Help
Entry
GFO_2674          CDS       T00448                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gfo  Gramella forsetii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GFO_2674 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GFO_2674 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GFO_2674 (trpA)
Enzymes [BR:gfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GFO_2674 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2791252..2792022
Genome map
AA seq 256 aa AA seqDB search
MNRINQKLQEDHKLLSIYFTAGYPDFEDTEKIIVDLEKSGVDFIEIGLPFSDPLADGPTI
QKSSTKALKNGMTTSKLFEQLKGIRNKVEIPLIIMGYFNPILQYGVEDFCKKCQETGIDG
LIIPDLPVDVYHEKYQELFEQYGLRNIFLITPQTSDERIHFIDSVSNGFIYMVSSASVTG
STSGFGEDTRAYFKRVNDLQLKNPQIVGFGIKDNETFNQATEYAKGAIIGSAFIKHINEN
GTSNVGSFVKKVKALT
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattaatcaaaaattgcaggaagaccataaactgctctcaatatattttact
gccgggtatcctgattttgaggatactgaaaagatcattgtagatctggaaaaaagtgga
gtcgattttattgaaatcggacttccttttagcgatccgctggcagatggaccaaccatt
cagaaaagttctaccaaagcgctcaaaaatggaatgacgacctcaaaattatttgagcaa
ctaaaaggtattaggaataaggttgaaattccacttattattatgggctattttaatcct
attttgcaatatggagtggaggatttctgtaaaaaatgccaggaaacgggaattgatgga
ctcattatcccagatcttccggtagacgtttatcatgaaaaatatcaggagttatttgaa
caatatggtttaagaaatatctttttaattactccccaaacttcagacgaacgtattcat
tttatagattcagtatccaacggattcatttatatggtaagtagtgcgagtgtgaccggt
tccacaagtggatttggtgaagataccagagcatattttaaaagagtaaatgatcttcag
cttaaaaatcctcaaattgtaggctttggaataaaagataacgaaacctttaatcaggct
actgaatatgcaaaaggagccattattggtagtgcttttattaagcacataaatgaaaat
ggaacttcaaacgttggttcatttgtgaagaaagtgaaggctttaacctaa

DBGET integrated database retrieval system