KEGG   Gramella forsetii: GFO_3082Help
Entry
GFO_3082          CDS       T00448                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gfo  Gramella forsetii
Pathway
gfo00020  Citrate cycle (TCA cycle)
gfo00310  Lysine degradation
gfo01100  Metabolic pathways
gfo01110  Biosynthesis of secondary metabolites
gfo01120  Microbial metabolism in diverse environments
gfo01130  Biosynthesis of antibiotics
gfo01200  Carbon metabolism
Module
gfo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gfo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GFO_3082 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    GFO_3082 (sucB)
Enzymes [BR:gfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GFO_3082 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H YL1 LAP1C CPSF100_C TFIIF_alpha Zip CDC45
Motif
Other DBs
NCBI-ProteinID: CAL68026
UniProt: A0M5Y1
Position
complement(3236275..3237591)
Genome map
AA seq 438 aa AA seqDB search
MALEMKVPSPGESITEVEIAQWLVEDGDYVEKDQAVAEVDSDKATLELPAEASGIITFKA
EEGDLVQVGEVVCLIDTEAEKPGGDGGSDDSEDKKDGKEAKEDDKSAEEEEKERQEKKED
KKDSDKAEAKTETPSKSSTPNQKQDTYASGSPSPAAKKILDEKGMDSKDVKGSGRDGRVT
KQDAVEAKASMGTPGTGTRGEEKKKMSMFRRKLAERLVSAKNDTAMLTTFNEVDMSPIFE
LRKKYKEEFKDKHGVSLGFMSFFTLAVIRALDEYPAVNSMIDGDYQISYDYKDISIAVSG
PKGLTVPVIRNAENLSFRGVESEVKRLAIKARDGKITVDEMTGGTFTITNGGVFGSMLST
PIINPPQSAILGMHNIVERPVAIDGHVEIRPIMYVALSYDHRIIDGKESVGFLVAIKEAL
ENPEELLMDNDVKRSLEL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccttagaaatgaaagttccttcacctggtgaatccatcactgaagttgaaatagcc
cagtggctggtagaagacggagattacgttgaaaaagatcaggcagttgccgaagttgat
agtgataaagctacccttgaacttcctgcggaagcaagcggaattatcacatttaaggct
gaagaaggtgatttggtacaagttggtgaagtagtgtgtctaattgataccgaagccgaa
aagccaggtggcgatggtggaagtgatgattctgaagataagaaagacggtaaagaagct
aaagaagacgataaatctgctgaagaagaggaaaaggaacgtcaggaaaagaaagaagat
aaaaaagacagcgataaagcagaggctaaaactgaaactccttcaaaatccagcactcca
aatcaaaaacaggatacgtatgcttcgggaagtccttctccggcagcgaagaagatcctt
gatgaaaaagggatggattccaaagatgtaaaaggttcaggtcgggacggccgtgttacc
aagcaggacgctgttgaagctaaagcttctatgggaactccaggaacaggtacaagaggc
gaggagaagaaaaaaatgtcgatgttccgtcgtaaacttgctgaacgtttggtaagtgcc
aagaatgatacagcgatgcttactacttttaacgaagtagatatgtctccaatatttgaa
cttagaaagaaatacaaagaagaatttaaagataaacacggggtaagccttggttttatg
tctttctttacattggccgtaattcgtgctttagacgagtatcctgctgtaaactctatg
atagatggagattaccagataagctatgattataaagatattagtatcgctgtttcagga
cctaaaggtttaacggtaccggtaattagaaatgctgaaaatttaagttttcgaggagta
gaatcagaagttaaacgtcttgcgataaaggcacgtgatggaaagatcaccgtagatgaa
atgacgggaggtactttcactatcaccaatggaggtgtatttggatcgatgctttcaact
ccaattattaatcctccgcagagtgctattcttggaatgcataatatcgtggagagaccg
gtagcaatagatggtcatgtagaaattagaccaatcatgtatgttgcattgtcttatgat
cacagaattatcgacggaaaagagtctgttggatttcttgtagctattaaagaagcactg
gaaaatcctgaagaattattgatggataatgatgtgaaaagatcgttggaactatag

DBGET integrated database retrieval system