KEGG   Gramella forsetii: GFO_3188Help
Entry
GFO_3188          CDS       T00448                                 

Gene name
pncA
Definition
bifunctional pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gfo  Gramella forsetii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:gfo00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3348591..3349202)
Genome map
AA seq 203 aa AA seqDB search
MRGLVIIDVQNDFMPGGALAVPDGDKIVPIVNDLQKKFDLVIATQDWHPSGHASFASSYE
NSKEFEIIKLDGLDQVLWPEHCIQNTKGANFHPDLDTSKIEAIFRKGTNKKIDSYSGFYD
NAHLKSTGLAGYLKEKGVTELYFVGLAAEYCVYFSIKDALLEGFEAILIEDGTRALRDGD
FEKIKVDILRKGGKIIDAKEVNF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtctagtgatcatagatgtgcaaaatgattttatgcccggtggtgcattagca
gttccagatggagataaaatagtgccgattgttaacgatcttcagaaaaaatttgatctg
gtaattgctacccaggactggcatccttcagggcatgcaagtttcgcatcatcatatgag
aattcaaaagaatttgaaataattaagctcgatggattagatcaggtgttatggccagaa
cattgtatccagaataccaaaggagcaaatttccatccagatcttgatacctcaaagatc
gaggcgatttttagaaaaggcaccaataaaaagatcgacagctatagcggtttctatgat
aatgcacatctaaaatctaccggtcttgcaggctatttaaaagagaaaggcgtaaccgaa
ctttattttgtaggccttgcagcggagtattgtgtttacttttcaattaaagatgcatta
ttagaaggtttcgaggcaattttaattgaagacggtacaagggccttgagggatggcgat
tttgaaaagattaaagtcgatattttaaggaaaggtggtaagattatagacgctaaggaa
gtaaatttttag

DBGET integrated database retrieval system