KEGG   Gramella forsetii: GFO_3188Help
Entry
GFO_3188          CDS       T00448                                 

Gene name
pncA
Definition
bifunctional pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gfo  Gramella forsetii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    GFO_3188 (pncA)
Enzymes [BR:gfo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     GFO_3188 (pncA)
    3.5.1.-  
     GFO_3188 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3348591..3349202)
Genome map
AA seq 203 aa AA seqDB search
MRGLVIIDVQNDFMPGGALAVPDGDKIVPIVNDLQKKFDLVIATQDWHPSGHASFASSYE
NSKEFEIIKLDGLDQVLWPEHCIQNTKGANFHPDLDTSKIEAIFRKGTNKKIDSYSGFYD
NAHLKSTGLAGYLKEKGVTELYFVGLAAEYCVYFSIKDALLEGFEAILIEDGTRALRDGD
FEKIKVDILRKGGKIIDAKEVNF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtctagtgatcatagatgtgcaaaatgattttatgcccggtggtgcattagca
gttccagatggagataaaatagtgccgattgttaacgatcttcagaaaaaatttgatctg
gtaattgctacccaggactggcatccttcagggcatgcaagtttcgcatcatcatatgag
aattcaaaagaatttgaaataattaagctcgatggattagatcaggtgttatggccagaa
cattgtatccagaataccaaaggagcaaatttccatccagatcttgatacctcaaagatc
gaggcgatttttagaaaaggcaccaataaaaagatcgacagctatagcggtttctatgat
aatgcacatctaaaatctaccggtcttgcaggctatttaaaagagaaaggcgtaaccgaa
ctttattttgtaggccttgcagcggagtattgtgtttacttttcaattaaagatgcatta
ttagaaggtttcgaggcaattttaattgaagacggtacaagggccttgagggatggcgat
tttgaaaagattaaagtcgatattttaaggaaaggtggtaagattatagacgctaaggaa
gtaaatttttag

DBGET integrated database retrieval system