KEGG   Gramella forsetii: GFO_3213Help
Entry
GFO_3213          CDS       T00448                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
gfo  Gramella forsetii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:gfo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3376544..3377425)
Genome map
AA seq 293 aa AA seqDB search
MFYLYKTLKYPDSYRDRVTLKFDNLGTFNKQIEMPELPEVAYQKIYVDSTSLHHKIVKVD
MGADKIFQSPKSEFEATLLKNEFVSSTQIGKYLLLKLKEKGYLVVHFGMTGKMDYFQHDE
IQKHAQLTLTFEDGGKLSFVCPRKFGKLFLTTSPDEFRKKQKLGPHATEISEEDFHNLFD
GKRGSVKTALMDQSFIAGLGNLYVDEILFQSGIHPKSKSENLSDKDLSNMFKNMVAILET
VTKSKTEGNPIPDTYLRNHRNEGEACPIAKGKIKMIKVGGRSTYFCSECQEEK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgttttatctttataagaccctgaaatatcccgatagctatcgggacagggtgacctta
aaatttgataacttagggacattcaataaacaaatagagatgccagaattaccggaagta
gcctatcaaaaaatatatgtagattcaactagtctccaccataaaatagtgaaagtggat
atgggagctgataaaatttttcaatcaccaaaaagtgaatttgaagcaactttgcttaaa
aatgagtttgtttccagcacacagattggaaaatatctattgttgaaattgaaggaaaaa
gggtatctggtagtgcattttggtatgaccggcaagatggattattttcagcatgatgag
attcaaaaacatgcacaactcactttaacttttgaagacggtggaaaactttcatttgta
tgtcccagaaaatttggaaagctttttctaacaacaagcccggatgaattcagaaaaaaa
cagaagctgggtccgcatgcaacagaaatatcagaagaagattttcataacttatttgac
ggcaaaagaggtagtgtgaaaacagcgttgatggatcagtcttttattgccggacttgga
aatttatatgtagacgaaatactatttcagagtggaattcatcctaaatcgaagtctgag
aatctctctgataaagatctttcaaatatgtttaaaaacatggtggctattctcgaaacg
gttaccaaaagtaaaacagaaggaaatccaattcccgatacttacttaagaaatcataga
aatgaaggcgaagcttgtcctattgctaagggcaaaataaaaatgataaaagtgggagga
agaagcacttatttttgttcggaatgtcaggaagaaaaatag

DBGET integrated database retrieval system