KEGG   Geospiza fortis (medium ground-finch): 102045517Help
Entry
102045517         CDS       T03755                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
gfr  Geospiza fortis (medium ground-finch)
Brite
Enzymes [BR:gfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102045517 (ABHD12)
Peptidases [BR:gfr01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102045517 (ABHD12)
Exosome [BR:gfr04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102045517 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 179 aa AA seqDB search
MTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIR
EEARSHPFSVIYRYFPGFDWFFLDPITTSGIKFANDENVKYISCSLLILHAEDDPVVPFH
LGKKLYNIAATSRSFRDYKVQFVPFHTDLGYRHKYIYRSPELPRILREFLGKSEHEHHH
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgacgcccttcatgtcttcgactggataaaagcccggagcggagacaacccc
gtctatatttggggacactccctgggcacaggagttgcaacaaacctggtgcggcgcctc
tgcgagagagaaacgcccccggatgccctgatcctggaatctccattcaccaacatacgg
gaggaggcgcggagtcatcccttttctgtgatatacagatacttccctggatttgactgg
ttcttccttgaccccatcacaacaagtggaattaaatttgcaaacgatgagaatgtgaaa
tacatttcctgctccctgctcatccttcatgctgaggatgatccagtggtaccatttcat
ctgggaaaaaagctttacaacatcgcagcgacgtcgcggagcttccgggactacaaggtg
cagtttgtgcccttccacacagacctgggctaccggcacaagtacatctacaggagtcca
gagctacctcggatactgcgggaattcctgggaaaatctgaacatgagcatcatcactga

DBGET integrated database retrieval system