KEGG   Gallus gallus (chicken): 100857136Help
Entry
100857136         CDS       T01006                                 

Definition
UDP-glucuronosyltransferase 1-1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
gga  Gallus gallus (chicken)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100857136
   00053 Ascorbate and aldarate metabolism
    100857136
   00500 Starch and sucrose metabolism
    100857136
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100857136
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100857136
   00860 Porphyrin and chlorophyll metabolism
    100857136
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100857136
   00982 Drug metabolism - cytochrome P450
    100857136
   00983 Drug metabolism - other enzymes
    100857136
Enzymes [BR:gga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100857136
Glycosyltransferases [BR:gga01003]
 Others
  Hydrophobic molecule
   100857136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
7
AA seq 558 aa AA seqDB search
MEEQSTSHSLLLSGSLHPHKALPTFYRREMASSHPGFHFLASWAVILLLLRIFSEGGKLL
VIPIDGSHWLSMRLVVEQLRHRGHEIVVVAPEINLRIGASMHYSMKTYSVSYTREFVEAE
FKKLGYKSFTPQTFLEKFSKITNITTMFFDSCKRLLSNKELMKYLEESMFDGVLMDPFFP
CGQIVAEHLSIPSVYLVRGLPCSLDFHATLCPNPPSYIPRFFTHYTDRMGFFQRLGNLLV
SLSSTLTCSFLYSPYDHLIKEFLQQEATLLELLSHASIWLMKYDFVFEYPRPVMPNMVLI
GGITCTQEKQISKEFEAIVNASGEHGIVVFSLGSMVSEIPMKKAMEIADALGSVPQTVLW
RYTGEVPPNLPKNVKLVKWLPQNDLLAHPKTRAFITHGGSHGVYEGICNAVPMVLMPLFG
DQMDNAKRVESRGAGLTLNILEMTSKDISDALKAVINDKKYKENIQRLSDLHLDRPIHPL
DLAVHWVEFVMRHKGAPHLRPAAHDLNWIQYHSLDVFAFLLAVVLLSLFISVKCCMFCCR
RCCFKKGRKSKSGKSKTH
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcaaagtacaagtcattctttgttgctttcgggatctctgcatccacataaa
gcattgccgacattctacagaagggaaatggcctcttcacatccaggatttcattttctt
gcctcctgggctgtgattctcctgctcctgaggatcttttctgaaggtgggaagcttttg
gttatccctattgatggcagtcactggcttagcatgcgcctggttgtggagcagctcaga
catagaggacatgaaattgtggttgttgctccagagataaatttgcgaataggtgcgtcg
atgcattatagcatgaaaacatactctgtgtcttacaccagagagtttgtggaggcagaa
tttaaaaagcttggctataagagtttcacacctcaaactttcttggaaaaattctcaaaa
ataacgaatattacaacgatgttttttgattcctgcaaaaggcttctttctaacaaagag
ctgatgaaataccttgaagaaagcatgtttgatggtgtccttatggatcctttttttccc
tgtggacagatagtggctgaacatctctccataccttctgtgtacctcgtacggggactg
ccgtgcagcctggacttccatgctaccctctgcccaaatcctccctcctacattcccagg
ttcttcacgcactacacagatcgtatggggttcttccagcgcctgggcaacctcctagtt
agcttgagcagtaccctaacctgtagctttctttattcaccgtatgatcatttgatcaaa
gaattccttcaacaagaggcaacactgcttgaacttttaagccatgcatctatttggctt
atgaaatacgactttgtgtttgagtatccgaggcctgtgatgcctaacatggtcttgatc
ggaggcataacctgcactcaggaaaaacagatatcaaaggaattcgaagccattgtaaat
gcttccggagaacacggtattgttgtcttctccctgggctccatggtctccgagatcccc
atgaagaaagccatggaaattgcagatgctttgggatcagtccctcaaacggttttgtgg
cgatacacaggagaggtgccccccaacctgccaaagaacgtgaagcttgtcaagtggctg
ccacagaatgacctcctagctcatcctaagactcgtgcctttattacccatggaggctca
cacggtgtttacgagggcatatgcaatgcagtgccaatggtgctaatgcctttatttgga
gaccagatggacaatgcgaaacgagtagagtcgcggggagcaggattgacactgaatata
ctagaaatgacttcgaaagacatatccgatgccctgaaagcagttattaatgataaaaag
tacaaagagaacatccagcgtctctcagacctccaccttgacaggcccatccaccctctg
gacctggctgtgcactgggtggagtttgtcatgagacacaaaggggccccacacctgcgc
cctgctgcccatgacctgaactggattcagtatcactccctggacgtctttgccttcctc
ctggctgtggtgctcctctccctcttcatttctgtgaagtgctgcatgttctgctgccgc
aggtgctgctttaagaagggaagaaaaagcaagtcagggaaatcaaagacccactag

DBGET integrated database retrieval system