KEGG   Gallus gallus (chicken): 100857298Help
Entry
100857298         CDS       T01006                                 

Definition
glucose-6-phosphatase-like
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100857298
   00052 Galactose metabolism
    100857298
   00500 Starch and sucrose metabolism
    100857298
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100857298
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100857298
   04920 Adipocytokine signaling pathway
    100857298
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100857298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
27
AA seq 432 aa AA seqDB search
MPYATLQPVFPLYASCSKHVCNNPPAMHPSAKVVLGPKINAGTSDLSAANTNLWGIKLHW
STGQPEPGRRLRRRMEAPMNLLHDAGIQATQWLQEHFQGSQDWFLFISFAADLRNTFFVL
FPIWFHLCEPVGIRLIWVAVIGDWLNLVFKWILFGERPYWWVHETDYYSNASAPAIQQFP
LTCETGPGSPSGHAMGAAGVYYVMVTALLSIAMGKKQSKTLKYWILWAMLWTGFWAVQVC
VCLSRIFIAAHFPHQVIAGVISGMAVAETFQHIHSIYHASLRRYLGITFFLFSFALGFYL
LLRMLGVELLWTLEKAQRWCAHPEWVHIDTTPFASLLRNLGILFGLGLALSSHMYLESCR
GKQGCQLSFRLGCAAASLLVLHLFDAFRPPSHIQLLFYVLSFCKSAAVPLATVGLIPYCI
SQFVATKDKKGV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgccctatgccaccctgcagcctgtttttcccctttatgcaagttgttccaaacacgtt
tgtaacaacccaccagcgatgcacccttcagcaaaagtggttttgggtccaaagatcaat
gctgggacaagtgacctatcggcagcaaacacgaacctgtggggtataaaactgcactgg
agcacgggacagcctgaaccaggcaggaggctgcggaggaggatggaagcccccatgaac
ctcctgcatgatgcaggcatccaggcgacacagtggctgcaggagcatttccagggctct
caggactggttcctcttcatctcctttgccgcagacctcaggaacactttctttgttctt
ttccctatctggttccatttgtgtgagccagtgggcatccggcttatctgggtggccgtg
atcggggactggctcaaccttgtcttcaagtggatcctgtttggggagaggccgtactgg
tgggtacacgagactgattattacagcaacgcctctgcgccggccatccagcagttccca
ctcacctgcgagaccggccctgggagcccctccggccatgccatgggtgcagcaggagtg
tactacgtcatggtgaccgccctgctttccatcgccatgggcaagaagcagtcaaaaaca
ctgaagtactggattctgtgggccatgctgtggacggggttctgggccgttcaggtctgc
gtctgtctgtcccgcattttcatcgctgctcactttcctcatcaggtcatcgcaggggtc
atatctggcatggccgtggctgagaccttccagcacatccactccatctaccatgccagc
ctccgcaggtacctgggcatcaccttcttcctcttcagcttcgccttgggcttctacctg
cttctgcggatgcttggtgttgaactgctctggacactggagaaggcacagaggtggtgt
gcccatcctgagtgggtccacatcgacaccacgcccttcgccagccttcttcgcaacctg
ggcatcctgtttgggctggggctggccctgagttcccacatgtacctggagagctgccgg
gggaagcaaggctgccagctgtccttccgcctaggctgtgctgctgcctcgctgctggtc
ctgcacctctttgatgccttcaggccaccctcccacatacagctgctcttctatgtcctt
tccttctgcaagagtgcagccgtgccgctggccaccgtcggcctcattccctactgcatc
tctcagtttgtggccacgaaggacaagaagggtgtctag

DBGET integrated database retrieval system