KEGG   Gallus gallus (chicken): 100857640Help
Entry
100857640         CDS       T01006                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1 (Drosophila)
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100857640 (SUV39H1)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100857640 (SUV39H1)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100857640 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100857640 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Position
Un
AA seq 372 aa AA seqDB search
PGHKAVPPPPPSPPQGEEFYLVKWRGYPDSANSWEPRKNLRCRGLLKQLHQDLARAPGGP
VRPGPRGLPPRASSFLVQKAEQRQALRRWEQHLNNTRSHRGRIAVENEVDLHGPPRDFVY
INEYKVGAGIQLTPVAVGCECSDCMAEAAGGCCPGASHNKFAYNEAGLVRIRAGLPIYEC
NSRCRCGSDCPNRVVQKGIRYDLCIFRTGNGRGWGVRTMERIRKNSFVMEYIGEIITSEE
AERRGQVYDRQGATYLFDLDYVEDVYTVDAAHYGNISHFVNHSCDPNLQVYNVFIENLDE
RLPRIALFATRPIRAGEELTFDYNMHVDPVDAESTRMDSNFGLTGGGLSSSPRSRGRIEC
KCGAAACRKYLF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
cctgggcacaaagctgtgccccctccccccccttcccctccacagggtgaggagttctac
ctggtgaagtggaggggatacccggacagcgccaacagctgggagccccgcaagaacctg
cgctgccgggggctgctgaagcagctgcaccaggacctggcgcgcgccccgggggggccg
gtgagacccggaccccgaggtttgcccccccgcgcctcctcgttcctggtgcagaaggcg
gagcagcggcaggcgctgcggcgttgggagcagcacctgaacaacacccgcagccaccgc
ggccgcatcgccgtggagaacgaggtggacttgcacggccccccccgggacttcgtctac
atcaacgagtacaaagtgggggccggcatccagctgacgcctgtggccgtgggctgcgag
tgcagcgactgcatggcggaggctgcgggcggctgctgccccggagcttcgcacaataag
tttgcctacaacgaggcggggttggtgcgcatccgggctgggctgcccatctacgagtgc
aactcgcggtgccgctgcggctccgactgccccaaccgcgtggtgcagaaggggatccgc
tacgacctctgcatcttccgcaccggcaacgggcgcgggtggggagtgcgcaccatggag
cgcatccgcaagaacagcttcgtgatggagtacattggggagatcatcacctcggaggag
gcggagcgccgcgggcaggtgtacgaccggcagggagccacgtacctcttcgacctggac
tacgtggaggacgtctacaccgtggatgccgcccactacggcaacatctcccacttcgtc
aaccacagctgcgaccccaacctgcaggtctacaacgtcttcattgagaacctggacgaa
cgcctgccccgcatcgccctcttcgccacccgccccatccgcgccggggaggagctcacc
tttgactacaacatgcatgtggacccagtagatgcagagagcacccgcatggactccaac
tttggactgaccggggggggcctgagcagctccccccgctcccggggccgcattgagtgc
aaatgcggggctgctgcctgccgcaagtacctcttctga

DBGET integrated database retrieval system