KEGG   Gallus gallus (chicken): 100857640Help
Entry
100857640         CDS       T01006                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100857640 (SUV39H1)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100857640 (SUV39H1)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100857640 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100857640 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo Diacid_rec
Motif
Other DBs
NCBI-GeneID: 100857640
NCBI-ProteinID: XP_015128706
CGNC: 65392
Ensembl: ENSGALG00000031839
UniProt: A0A1D5PF98
Position
Un
AA seq 412 aa AA seqDB search
MAENLKGCSVCCKSTWAQLRELCRAGRLRCAALGVTRRNLGEFEVEYLCDYKRVGGEEFY
LVKWRGYPDSANSWEPRKNLRCRGLLKQLHQDLARAPGGPVRPGPRGLPPRASSFLVQKA
EQRQALRRWEQHLNNTRSHRGRIAVENEVDLHGPPRDFVYINEYKVGAGIQLTPVAVGCE
CSDCMAEAAGGCCPGASHNKFAYNEAGLVRIRAGLPIYECNSRCRCGSDCPNRVVQKGIR
YDLCIFRTGNGRGWGVRTMERIRKNSFVMEYIGEIITSEEAERRGQVYDRQGATYLFDLD
YVEDVYTVDAAHYGNISHFVNHSCDPNLQVYNVFIENLDERLPRIALFATRPIRAGEELT
FDYNMHVDPVDAESTRMDSNFGLTGGGLSSSPRSRGRIECKCGAAACRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgctccgtctgctgcaagtcgacgtgggcgcagctgcgg
gagctgtgccgggccgggcggctgcgctgcgccgcgctcggagtcacccggaggaacctc
ggcgagttcgaggtggaatatctgtgcgactacaaacgagtcgggggtgaggagttctac
ctggtgaagtggaggggatacccggacagcgccaacagctgggagccccgcaagaacctg
cgctgccgggggctgctgaagcagctgcaccaggacctggcgcgcgccccgggggggccg
gtgagacccggaccccgaggtttgcccccccgcgcctcctcgttcctggtgcagaaggcg
gagcagcggcaggcgctgcggcgttgggagcagcacctgaacaacacccgcagccaccgc
ggccgcatcgccgtggagaacgaggtggacttgcacggccccccccgggacttcgtctac
atcaacgagtacaaagtgggggccggcatccagctgacgcctgtggccgtgggctgcgag
tgcagcgactgcatggcggaggctgcgggcggctgctgccccggagcttcgcacaataag
tttgcctacaacgaggcggggttggtgcgcatccgggccgggctgcccatctacgagtgc
aactcgcggtgccgctgcggctccgactgccccaaccgcgtggtgcagaaggggatccgc
tacgacctctgcatcttccgcaccggcaacgggcgcgggtggggagtgcgcaccatggag
cgcatccgcaagaacagcttcgtgatggagtacatcggggagatcatcacctcggaggag
gcggagcgccgcgggcaggtgtacgaccggcagggagccacgtacctcttcgacctggac
tacgtggaggacgtctacaccgtggatgccgcccactacggcaacatctcccacttcgtc
aaccacagctgcgaccccaacctgcaggtctacaacgtcttcattgagaacctggacgaa
cgcctgccccgcatcgccctcttcgccacccgccccatccgcgccggggaggagctcacc
tttgactacaacatgcatgtggacccagtagatgcagagagcacccgcatggactccaac
tttggactgaccggggggggcctgagcagctccccccgctcccggggccgcattgagtgc
aaatgcggggctgctgcctgccgcaagtacctcttctga

DBGET integrated database retrieval system