KEGG   Gallus gallus (chicken): 100857640Help
Entry
100857640         CDS       T01006                                 

Gene name
SUV39H1
Definition
suppressor of variegation 3-9 homolog 1 (Drosophila)
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100857640 (SUV39H1)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100857640 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
Un
AA seq 372 aa AA seqDB search
PGHKAVPPPPPSPPQGEEFYLVKWRGYPDSANSWEPRKNLRCRGLLKQLHQDLARAPGGP
VRPGPRGLPPRASSFLVQKAEQRQALRRWEQHLNNTRSHRGRIAVENEVDLHGPPRDFVY
INEYKVGAGIQLTPVAVGCECSDCMAEAAGGCCPGASHNKFAYNEAGLVRIRAGLPIYEC
NSRCRCGSDCPNRVVQKGIRYDLCIFRTGNGRGWGVRTMERIRKNSFVMEYIGEIITSEE
AERRGQVYDRQGATYLFDLDYVEDVYTVDAAHYGNISHFVNHSCDPNLQVYNVFIENLDE
RLPRIALFATRPIRAGEELTFDYNMHVDPVDAESTRMDSNFGLTGGGLSSSPRSRGRIEC
KCGAAACRKYLF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
cctgggcacaaagctgtgccccctccccccccttcccctccacagggtgaggagttctac
ctggtgaagtggaggggatacccggacagcgccaacagctgggagccccgcaagaacctg
cgctgccgggggctgctgaagcagctgcaccaggacctggcgcgcgccccgggggggccg
gtgagacccggaccccgaggtttgcccccccgcgcctcctcgttcctggtgcagaaggcg
gagcagcggcaggcgctgcggcgttgggagcagcacctgaacaacacccgcagccaccgc
ggccgcatcgccgtggagaacgaggtggacttgcacggccccccccgggacttcgtctac
atcaacgagtacaaagtgggggccggcatccagctgacgcctgtggccgtgggctgcgag
tgcagcgactgcatggcggaggctgcgggcggctgctgccccggagcttcgcacaataag
tttgcctacaacgaggcggggttggtgcgcatccgggctgggctgcccatctacgagtgc
aactcgcggtgccgctgcggctccgactgccccaaccgcgtggtgcagaaggggatccgc
tacgacctctgcatcttccgcaccggcaacgggcgcgggtggggagtgcgcaccatggag
cgcatccgcaagaacagcttcgtgatggagtacattggggagatcatcacctcggaggag
gcggagcgccgcgggcaggtgtacgaccggcagggagccacgtacctcttcgacctggac
tacgtggaggacgtctacaccgtggatgccgcccactacggcaacatctcccacttcgtc
aaccacagctgcgaccccaacctgcaggtctacaacgtcttcattgagaacctggacgaa
cgcctgccccgcatcgccctcttcgccacccgccccatccgcgccggggaggagctcacc
tttgactacaacatgcatgtggacccagtagatgcagagagcacccgcatggactccaac
tttggactgaccggggggggcctgagcagctccccccgctcccggggccgcattgagtgc
aaatgcggggctgctgcctgccgcaagtacctcttctga

DBGET integrated database retrieval system