KEGG   Gallus gallus (chicken): 100857897Help
Entry
100857897         CDS       T01006                                 

Definition
protein disulfide-isomerase A2-like
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100857897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
14
AA seq 521 aa AA seqDB search
MRGGAVLCGLLLSLAWLGPEEEDEEDEVLSDELEEEDGVLVLHEHNFERALREHRLLLVE
FYAPWCGHCRRLAPEFARAAALLRNGSESARLGKVDAVAQTALSAEFHIEAFPTLKLFRD
GNRTHPVAYSGRMDAEGMALWVQRRAGPSATLLHDADTAAAFVSARDIAAVGFFKDLRGE
AARAFYEVAAEVVDVAFGVAEADELFEAYGLSADTVCLFKKFDEGRTDFPVDPEQGLDVA
KLTRLLRVHSLQLVMDFSNETSSQIFGAKIPHHMLLFLNTSVAEQQALRDEFRVAAGTFR
GEVLFVVVDVDGYGATVLPFFGLKPSDAPTLRFIKMENNRKYRMEEDAFSATAVRDFVRA
VLDGKVKPQLLSAEPPEDWDTRPVKVLVGKTFEQVAFDETKNVFVKFYAPWCTHCQEMAA
AWEELGERYKDHEDIVIAEMDATANELENITISGYPTLHYFPAGPGRKMVEYRSARDVET
FSKFLENGGKLPEEPPTVSKAPENSTESPSPSGAAEAREEL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcggcgcggtgctgtgcgggctgctgctgtcgctggcctggctgggcccggag
gaggaggatgaagaggatgaggtgctctcagatgagctggaggaggaggacggcgtcctg
gtgctccacgagcacaacttcgagcgcgccctgcgcgagcaccggctgctgctggtggag
ttctacgctccgtggtgcgggcactgccgccgcctggcccccgagttcgcccgtgcggcc
gcgttgctgaggaacggatcggagtcagcacggctgggcaaggtggacgccgtggcgcag
acggccctgagcgccgagttccacatcgaggccttccccacgctcaaactcttccgcgac
ggcaatcgcacccaccctgtggcgtacagcggccgcatggacgccgagggcatggcgctc
tgggtgcagcgccgggccgggcccagcgccacgttgctgcacgacgccgacaccgccgcc
gccttcgtcagcgcgcgggacatcgccgccgtgggcttcttcaaggacctgcgcggggag
gcagcgcgggcgttctacgaggtggccgcggaggtggtggatgtggcgttcggggtggcc
gaggcggatgagctgttcgaggcgtatgggctgtcggccgacaccgtctgcctcttcaag
aagttcgatgaggggcggacggacttccccgtggacccggagcagggcctggacgtggcc
aagctgacgcggctgctccgcgtgcacagcctgcagttggtgatggacttctccaatgag
acctccagccagatcttcggggccaagatcccccaccacatgctgctcttcctcaacacc
tccgtagcagagcagcaggcgctgcgggatgagttccgtgtggctgctggcaccttccgc
ggcgaggtgctcttcgtggtggtggatgtggatgggtacggtgccaccgttctgcccttc
ttcggcctgaagcccagcgatgcgcccacactgcgcttcatcaagatggagaacaaccgt
aagtaccgcatggaggaggacgccttctcagccacggccgtacgcgacttcgtgcgggca
gtgctggacggcaaggtgaagccccagctgctgagcgcagagccccccgaggactgggac
acgcggcccgttaaagtgctcgtggggaagacctttgagcaggtggcgttcgatgagacc
aagaacgtcttcgtgaagttctatgcgccatggtgcacccactgccaggagatggcggct
gcctgggaggagctgggcgagcgctacaaggaccacgaggacatcgtcattgctgagatg
gacgccacggccaacgagctggagaacatcaccatcagcggatacccaacactgcactac
ttccctgctgggccgggcaggaagatggttgaatataggagcgcccgagacgtggagacc
ttctccaagttcctggaaaatggagggaagctgccggaggagccacctacggtgtccaag
gccccggagaacagcacagagtcaccgagcccatccggtgcagctgaagcacgggaggag
ctgtga

DBGET integrated database retrieval system