KEGG   Gallus gallus (chicken): 100858275Help
Entry
100858275         CDS       T01006                                 

Definition
dual specificity testis-specific protein kinase 2-like
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100858275
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: TKL group
  LISK family [Table]
   100858275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
8
AA seq 670 aa AA seqDB search
MDRSKRNSIAGFPPRLERAEDFDGGTGGDGTTSQIGRVWTSSYRALISAFSRLTRLDDFT
CEKIGSGFFSEVFKVRHRTSDQVMALKMNTLNSNRANMLKEVQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINYGNLEQLLDSNQHLSWTVRVKLAYDIAMGISYLHYKGIFHRDLTSK
NCLIKHDENGYSAIVGDFGLAEKIPDHSEKLPVVGSPFWMAPEVLRDEPYNEKADVFSYG
IILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLAFNCCNMDPKLRPSFA
DIVKTLEEILNRLRNEDSERDRKFLNLDNNERKPKGSIEKGPGVKRLSSLDDKIPPKSPR
PRRNIWLSRSQSDIFSRKPSRKINVQDPYYTPNKGLGRKVNPFSAREDLKGGKIKFFDMP
SKSVISLVFDLHSPEAGGCLKASQSQFRQAYSTDWQEFSLLPGRRCRSLPVSPELAHKEY
GLFSGLSSTISRCDPTQLSAEVRQKLLSSSKYGVSEIPPFQAKHHRPEFLSVPGQEEDMD
CSDGPVSQEENGFYSENTCEDPARNQPLVLAQSEPLSYKGLPVENSLNSEEHSSQVFAGC
LPSEEMEVEDNLLKNTLLESTKPLFSVCPSTELRTDARPFREHDGDSTAPLSQTSSNISA
SGSTQPTCDI
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggaccgaagtaaaaggaattcaatagcaggatttccacctcgcttggagcgtgctgag
gactttgatggtggcactggaggagatgggactacatcccagatagggagagtttggacc
tcttcatacagagccctgataagtgccttttccagacttacccgtctcgatgacttcaca
tgtgagaaaattggctctggtttcttctctgaggtgttcaaggtaagacacagaacttca
gaccaggtaatggctttgaagatgaacacgctgaacagcaacagagcaaacatgctgaaa
gaggttcaacttatgaatagactctcacatccaaacatcttaaggtttatgggtgtctgt
gtgcatcaaggacagctgcacgcacttactgagtacatcaactatggtaacctggaacag
ctattagacagtaaccagcatctgtcctggacagtgagggtgaaattggcatatgacatc
gctatgggaatcagttatcttcactacaaaggcattttccatcgagaccttacatccaag
aactgcttaataaaacatgatgagaatggatactcagcgatagtgggagactttggttta
gcagagaaaattccagatcacagtgagaagctaccagtggtggggtcacctttctggatg
gcaccagaagttctcagagatgaaccttacaatgaaaaggcagatgtgttctcctatggt
ataattctgtgtgagataatagcaagaatacaggcagatccagactatctccctcgtaca
gagaattttggattagattatgatgccttccagcacatggtgggagactgtccccctgac
ttcctccagctggctttcaactgctgtaatatggatccaaagttgcgtccttcatttgct
gatattgtcaaaacactggaggagattttaaaccgcctgagaaatgaggactctgagaga
gacagaaagtttttgaatcttgacaacaatgaaagaaaacctaaagggtcaattgaaaaa
ggaccaggagtaaaacgtttgagttccctggacgataagattccacccaagtcaccccgt
ccacgtcggaatatctggttgtcacgtagccaatcggatatcttctcccgcaagccttcc
aggaagataaatgtgcaggacccctactacacaccaaacaaaggattaggccggaaagtt
aatcccttcagtgcccgggaggacctcaagggtggaaagataaaattctttgacatgcca
agcaagtctgtgatctctcttgtgtttgacttgcattctccagaggcgggtggttgcctg
aaagccagccagtcccagttccggcaggcatatagcacagactggcaggaattttccctc
cttcctgggaggagatgcagatcacttccagtctctcccgaattggcacacaaagaatac
ggcctgtttagtggactgtcttcaaccatcagtagatgtgatccaacccagctaagtgca
gaggttcggcaaaagctcctgagtagcagtaaatatggtgtatcagagattccccccttt
caagccaagcatcacaggccagaatttctttctgtaccaggacaagaggaggatatggac
tgttcggatgggccagtgtcccaggaggaaaatggattttactctgagaacacatgtgaa
gatccagcacgtaatcaaccattagtgctggcccagtctgagccattatcttacaaaggg
ctcccagttgagaattcattgaactctgaggaacactcctcacaggtgtttgctggttgt
ctcccttctgaagagatggaggtggaagacaacctgctgaaaaatacactgctggagtct
acaaagcctctgttcagtgtttgtccttccacggagctgaggacagatgcacggccattc
agggagcacgacggggacagcactgccccattgtctcagacatcctccaacatctcagca
agtggcagcacgcagccaacttgtgacatatga

DBGET integrated database retrieval system