KEGG   Gallus gallus (chicken): 100858386Help
Entry
100858386         CDS       T01006                                 

Definition
uncharacterized LOC100858386
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:gga04010]
Cellular Processes; Cell communication; Gap junction [PATH:gga04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:gga04912]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 843 aa AA seqDB search
MESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYIHSANVLHRDLKPSNLLVNENCELKIG
DFGMARGLGADPRHSKAFLTEYVATRWYRAPELLLSLHRYTRAIDMWSVGCIFAEMLGRR
QLFPGRNYVHQLQLIMAVLGTPPAGVMAAIGAERVRAYLQSLPPRPPVPWESLYGDAEPA
ALALLGRMLRFDPRERVGVAEALRHPFLAKYHDPEDEPECIPAFDFAFERRVLTKEEIKA
AIVAEIEDFHQRRDGIRRHIAFAGGGGGGGSNGARWAVADVGARWGQRGQCWGQRGRYGR
RWGQRGQCWGQRGRYGRRWGQWGRCWGQWGRCWGQRGQYWGQRGQCWGQRGQYGQHWGQW
GGVGVSVANMANVGVNTAKVGVNTANVGVSVANMANVGGSGGGVGVNAANMANASINAAN
VGVNVANVGVNRANVGVNVANMANIGVNMANVGVSVANIGVNVANAGINMATMANAGVRM
INVANAGIHMANAGINMANAGVTVTNLANAGIGMANVANVNVNMANAGVSMANMANATIN
MANSGVNMANMANATINMANSGVNMANMANATINMANSGVSMANMANTCVNMANMANAGI
NMANAGINMANPSINMANMANAGINMANAGINMANPGLNMANTGVNMANMANAGLNMANT
GINMANMANTSVNMANMANSGVNMANPGLNMANPGINMANIANSGVNMANMANSSVNMAN
MANTGVNMANMANSGVNMANAGINMANMAAISSSAATTTVSGTDPSVPTPWPCTDVDMAS
PGPTAAPDCPMESPRVKAEPEVPVAPKRDGAISDDTKAALKAALLKSAMRNKSRGVGGAG
GMW
NT seq 2530 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggacctccaccagatcatccactcctcgcagcccctgactttggaacacgtc
cgctacttcctctaccagctccttcgcggcctcaaatacatccattcggccaacgtcctc
caccgggacctcaaaccttccaaccttttggtcaacgagaactgcgagctgaagatcggc
gatttcggtatggccagggggctcggagcggacccccgccatagcaaagccttcctgacc
gaatacgtggccacacggtggtaccgggctccggaactgctcctatccttacaccgttac
acccgagccatcgacatgtggtcggtgggttgcatcttcgccgagatgttgggccgccga
cagctcttcccgggtcgcaattacgtccatcagctgcagctcatcatggccgtcctgggg
accccccccgcgggcgtcatggcggccatcggggccgagagggtccgcgcctacctgcag
agcctcccccctcgccccccggtgccgtgggagagcctttacggcgacgccgagccggcg
gcgttggcgctgttggggaggatgctgaggttcgaccccagggagagggtgggggtggcc
gaagcgttgcgccatcccttcctggccaaataccacgaccccgaggatgagcccgagtgc
atcccggccttcgacttcgccttcgagcgccgcgtgctcaccaaggaggagatcaaagcc
gccatcgtggccgagatcgaggatttccaccagcgccgcgacggcatccgaaggcacatc
gcctttgccggcggcggcggcggcggtgggtcaaatggggcgcggtgggccgtggccgac
gttggggcgcggtggggtcagcgcggccaatgttggggtcagcgtggtcgatatggccga
cgttggggtcagcgcggccaatgttggggtcaacgtggccgatatggccgacgttggggg
cagtgggggcggtgttgggggcagtgggggcggtgttggggtcaacgcggccaatattgg
ggtcaacgtggccaatgttggggtcagcgtggccaatatggccaacattgggggcagtgg
ggcggcgttggggtcagcgtggccaatatggccaatgttggggtcaacacggccaaagtt
ggggtcaacacagccaatgttggggtcagcgtggccaatatggccaacgttgggggcagt
gggggcggtgttggggtcaacgcggccaatatggccaatgccagcatcaacgcagccaac
gtcggggtcaacgtggccaacgttggggtcaatagggccaatgttggggtcaacgtggcc
aacatggccaatatcggggtcaacatggccaacgttggggtcagtgtggccaatattggg
gtcaacgtggccaacgccggcatcaacatggccactatggccaatgccggcgtccgtatg
atcaacgtggccaacgccggcatccatatggccaacgccggcatcaatatggccaacgcc
ggcgtcaccgtgaccaacctggccaacgccggcatcggcatggccaacgtggccaacgtc
aacgtcaatatggccaacgccggcgtcagtatggccaatatggccaacgctaccatcaat
atggccaacagtggtgttaatatggccaatatggcaaacgctaccatcaatatggccaac
agtggtgttaatatggccaatatggccaacgctaccatcaatatggccaacagtggtgtc
agtatggccaacatggccaacacttgtgtcaatatggccaatatggccaacgccggcatc
aatatggccaacgccggcatcaatatggccaaccccagcatcaatatggccaatatggcc
aacgccggcatcaatatggccaacgccggcatcaatatggccaaccccggccttaatatg
gccaacaccggagtcaatatggccaatatggccaacgccggcctcaatatggccaacacc
ggcatcaatatggccaatatggccaacaccagtgtcaatatggccaatatggccaacagc
ggtgtcaatatggccaaccccggcctcaatatggccaaccccggcatcaatatggccaat
atagccaacagtggtgttaatatggccaatatggccaacagtagtgtcaatatggccaat
atggccaacaccggcgtcaatatggccaatatggccaacagcggtgtcaatatggccaac
gccggcatcaatatggccaacatggccgccatcagcagcagcgcggccaccaccaccgtc
agcggcaccgacccctccgtccccacgccgtggccctgcaccgatgtggacatggcgagc
cccggccccacggcggcccccgattgccccatggaatcgccgcgggtcaaagcggaaccg
gaggtcccggtggcaccaaaacgggacggcgccatctccgacgacaccaaagcggccctc
aaagcggcgctgctgaaatccgccatgaggaataagagtagaggtgtggggggcgccggg
gggatgtggg

DBGET integrated database retrieval system