KEGG   Gallus gallus (chicken): 100858386Help
Entry
100858386         CDS       T01006                                 

Definition
uncharacterized LOC100858386
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100858386
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100858386
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100858386
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100858386
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100858386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 843 aa AA seqDB search
MESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYIHSANVLHRDLKPSNLLVNENCELKIG
DFGMARGLGADPRHSKAFLTEYVATRWYRAPELLLSLHRYTRAIDMWSVGCIFAEMLGRR
QLFPGRNYVHQLQLIMAVLGTPPAGVMAAIGAERVRAYLQSLPPRPPVPWESLYGDAEPA
ALALLGRMLRFDPRERVGVAEALRHPFLAKYHDPEDEPECIPAFDFAFERRVLTKEEIKA
AIVAEIEDFHQRRDGIRRHIAFAGGGGGGGSNGARWAVADVGARWGQRGQCWGQRGRYGR
RWGQRGQCWGQRGRYGRRWGQWGRCWGQWGRCWGQRGQYWGQRGQCWGQRGQYGQHWGQW
GGVGVSVANMANVGVNTAKVGVNTANVGVSVANMANVGGSGGGVGVNAANMANASINAAN
VGVNVANVGVNRANVGVNVANMANIGVNMANVGVSVANIGVNVANAGINMATMANAGVRM
INVANAGIHMANAGINMANAGVTVTNLANAGIGMANVANVNVNMANAGVSMANMANATIN
MANSGVNMANMANATINMANSGVNMANMANATINMANSGVSMANMANTCVNMANMANAGI
NMANAGINMANPSINMANMANAGINMANAGINMANPGLNMANTGVNMANMANAGLNMANT
GINMANMANTSVNMANMANSGVNMANPGLNMANPGINMANIANSGVNMANMANSSVNMAN
MANTGVNMANMANSGVNMANAGINMANMAAISSSAATTTVSGTDPSVPTPWPCTDVDMAS
PGPTAAPDCPMESPRVKAEPEVPVAPKRDGAISDDTKAALKAALLKSAMRNKSRGVGGAG
GMW
NT seq 2530 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggacctccaccagatcatccactcctcgcagcccctgactttggaacacgtc
cgctacttcctctaccagctccttcgcggcctcaaatacatccattcggccaacgtcctc
caccgggacctcaaaccttccaaccttttggtcaacgagaactgcgagctgaagatcggc
gatttcggtatggccagggggctcggagcggacccccgccatagcaaagccttcctgacc
gaatacgtggccacacggtggtaccgggctccggaactgctcctatccttacaccgttac
acccgagccatcgacatgtggtcggtgggttgcatcttcgccgagatgttgggccgccga
cagctcttcccgggtcgcaattacgtccatcagctgcagctcatcatggccgtcctgggg
accccccccgcgggcgtcatggcggccatcggggccgagagggtccgcgcctacctgcag
agcctcccccctcgccccccggtgccgtgggagagcctttacggcgacgccgagccggcg
gcgttggcgctgttggggaggatgctgaggttcgaccccagggagagggtgggggtggcc
gaagcgttgcgccatcccttcctggccaaataccacgaccccgaggatgagcccgagtgc
atcccggccttcgacttcgccttcgagcgccgcgtgctcaccaaggaggagatcaaagcc
gccatcgtggccgagatcgaggatttccaccagcgccgcgacggcatccgaaggcacatc
gcctttgccggcggcggcggcggcggtgggtcaaatggggcgcggtgggccgtggccgac
gttggggcgcggtggggtcagcgcggccaatgttggggtcagcgtggtcgatatggccga
cgttggggtcagcgcggccaatgttggggtcaacgtggccgatatggccgacgttggggg
cagtgggggcggtgttgggggcagtgggggcggtgttggggtcaacgcggccaatattgg
ggtcaacgtggccaatgttggggtcagcgtggccaatatggccaacattgggggcagtgg
ggcggcgttggggtcagcgtggccaatatggccaatgttggggtcaacacggccaaagtt
ggggtcaacacagccaatgttggggtcagcgtggccaatatggccaacgttgggggcagt
gggggcggtgttggggtcaacgcggccaatatggccaatgccagcatcaacgcagccaac
gtcggggtcaacgtggccaacgttggggtcaatagggccaatgttggggtcaacgtggcc
aacatggccaatatcggggtcaacatggccaacgttggggtcagtgtggccaatattggg
gtcaacgtggccaacgccggcatcaacatggccactatggccaatgccggcgtccgtatg
atcaacgtggccaacgccggcatccatatggccaacgccggcatcaatatggccaacgcc
ggcgtcaccgtgaccaacctggccaacgccggcatcggcatggccaacgtggccaacgtc
aacgtcaatatggccaacgccggcgtcagtatggccaatatggccaacgctaccatcaat
atggccaacagtggtgttaatatggccaatatggcaaacgctaccatcaatatggccaac
agtggtgttaatatggccaatatggccaacgctaccatcaatatggccaacagtggtgtc
agtatggccaacatggccaacacttgtgtcaatatggccaatatggccaacgccggcatc
aatatggccaacgccggcatcaatatggccaaccccagcatcaatatggccaatatggcc
aacgccggcatcaatatggccaacgccggcatcaatatggccaaccccggccttaatatg
gccaacaccggagtcaatatggccaatatggccaacgccggcctcaatatggccaacacc
ggcatcaatatggccaatatggccaacaccagtgtcaatatggccaatatggccaacagc
ggtgtcaatatggccaaccccggcctcaatatggccaaccccggcatcaatatggccaat
atagccaacagtggtgttaatatggccaatatggccaacagtagtgtcaatatggccaat
atggccaacaccggcgtcaatatggccaatatggccaacagcggtgtcaatatggccaac
gccggcatcaatatggccaacatggccgccatcagcagcagcgcggccaccaccaccgtc
agcggcaccgacccctccgtccccacgccgtggccctgcaccgatgtggacatggcgagc
cccggccccacggcggcccccgattgccccatggaatcgccgcgggtcaaagcggaaccg
gaggtcccggtggcaccaaaacgggacggcgccatctccgacgacaccaaagcggccctc
aaagcggcgctgctgaaatccgccatgaggaataagagtagaggtgtggggggcgccggg
gggatgtggg

DBGET integrated database retrieval system