KEGG   Gallus gallus (chicken): 100858607Help
Entry
100858607         CDS       T01006                                 

Gene name
HIST1H2BO, H2B.2, H2B/n, H2BFN, HIST1H2B7L3, dJ193B12.2
Definition
(RefSeq) histone cluster 1, H2bo
  KO
K11252  histone H2B
Organism
gga  Gallus gallus (chicken)
Brite
Chromosome [BR:gga03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100858607 (HIST1H2BO)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100858607 (HIST1H2BO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like HMG14_17
Motif
Other DBs
NCBI-GeneID: 100858607
NCBI-ProteinID: XP_004937730
CGNC: 64486
Structure
PDB: 

Jmol
Position
1
AA seq 195 aa AA seqDB search
MGERIGGHPMVGARCGDATNTNFQPMPVRRCGAAALHSAAIKAAPAVGCVTALRACVLVV
FCELVRCSAMPEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHP
DTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA
VSEGTKAVTKYTSSK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggagagcggatcggcgggcacccaatggtgggcgcgcgttgtggtgacgccacaaac
acgaacttccagccaatgccagtgcggcgctgcggagctgctgctttgcatagcgccgct
ataaaggcggctcctgcggtcggctgcgttactgcgctccgagcgtgtgtgctggttgtg
ttttgcgagctcgttcggtgttcagctatgcccgagccggctaagtccgcgcccgccccg
aagaagggctccaagaaggcggtcaccaagacccagaagaagggcgacaagaagcgcaag
aagagccgcaaggagagctactcgatctacgtgtacaaggtgctgaagcaggtgcacccc
gacacgggcatctcgtccaaggccatgggcatcatgaactcgtttgtcaacgacatcttc
gagcgcatcgccggcgaggcgtcgcgcctggcgcactacaacaagcgctcgaccatcacg
tcgcgggagatccagacggccgtgcggctgctgctgcccggcgagctggccaagcacgcg
gtctccgagggcaccaaggcggtcaccaagtacaccagctccaagtag

DBGET integrated database retrieval system