KEGG   Gallus gallus (chicken): 100858727Help
Entry
100858727         CDS       T01006                                 

Gene name
USP19
Definition
ubiquitin specific peptidase 19
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.1.2.15]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100858727 (USP19)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100858727 (USP19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
12
AA seq 1362 aa AA seqDB search
MSSSTNAPGQRRVSRGLDDATNKKKQKDRANQESKEVSRPELEQAETSQERDLEEELLLD
WKQNADEIIVKLNLGSGSLKVEDVDTFFTDTDCVIKLPDGRQWSCQFYEEIEGSCSKIQC
KKGNFLQLVLQKKIPLHTWSSLLKRKKDGSKELGKGATCWENGKEKASSAELAPEEPRTE
STELPRTRREPSNPKRAQGRSEALGGKSPASPGTQSGPSAKRAVYLKVAPAEEEPNTRVT
GSVEPSKGHGGRSGSRRNGRASQGDVPTALTDLAPPLEKAVIMAKETVPVEMPPLAATTE
VFPHRVATCVEKRVLQPGSPVEASRGRESAPVLGESSKAIPSATRPLGRDGEKRDWSKDD
VALEAAADEPEPFVSLTFVKNDSYEKGNDLVVVHVYVKEIHKETSKVFFREQDFTLVFQT
SDINFLRLHPGCGPHTVFRWQVKLRNLIEPDQCTYNFTASRIDVCLKKRHSQRWGGLEAP
ATRGAVGGAKVAMPTGPTPLDKTPPGSNQHPLSSKEEARTSEKEKPRVEDGSLDGVAART
AQEHVTVKQEPHIPSPKPTCMVPPMTHSPVSAESVEDDEDEDEKKKVCLPGFTGLVNLGN
TCFMNSVIQSLSNTRELRDYFHDRSFESEINYNNPLGTGGRLAIGFAMLLRALWKGTHHA
FQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDE
VVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCSKVSITFDPFLYLPVPLPQKQKVLT
VYYFAKEPHKKPIKFLVSISKENSSAMEVLDSVAHSVHVKPDNLRLAEVIKNRFQRMFLP
SQSLDTVSPTDLLLCFEVLSPELAKERVVELQVQQRPQVPSVPVAKCAACQKKQLSEEEK
LRRCTRCYRVGYCNVTCQKTHWPDHKALCRPENIGFPFLISVPESRLTYARLAQLLEGYA
RYSVSVFQPPFQLGRMSPEQGLQPLLLDKLEPLAKGSCAAATSAPELGDGDRASGLLQEP
PLSPAVPELYPEMSDTGTVRSKVLAARSSLLSLDSGFSEHMDLQGDSCCEKEPSYERALK
PEAAIPGYQHTPDSLSARATQFYINKIDAANKEYKLEDKGDTPLELTDDCSLALVWKNNE
RLKEFVLVESKELECVEDPSSASEAARAGHFTLEQCLNLFTKPEVLAPEEAWYCPKCKQH
REASKQLMLWRLPNVLIIQLKRFSFRSFIWRDKINDMVDFPVRSLDLSKFCIGRKGEQQL
PMYDLYAVINHYGGMIGGHYTAYARLPNDKNSQRSDVGWRLFDDSTVTTVDESQVVTRYA
YVLFYRRRNSPVERPLPGHPPDHRAERTPSAEAAASQHCPTR
NT seq 4089 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcagcaccaatgcccctggccagaggagagtgtctcggggcttggatgatgcc
accaacaagaagaagcagaaggatcgagccaaccaggagagcaaggaagtgtctcgccct
gagctcgagcaggctgagacctcccaggagagggacttggaggaggagttgctgctggac
tggaaacagaatgctgatgagatcattgtcaagctgaacttgggaagtggatctctgaag
gtggaggacgtggatacttttttcaccgatactgactgtgtgatcaaactaccagatggg
cgccagtggagctgtcagttctatgaggagattgagggctcctgcagcaagatacagtgc
aagaagggaaactttctgcagcttgtgcttcagaagaagatccctctccacacctggtct
tcacttctgaagagaaagaaagatggatccaaagagctgggcaagggggccacgtgctgg
gagaacgggaaagagaaggcttcttctgcagaattggcccctgaagagccacggactgaa
agcactgagctgccaagaacccgccgagagccctccaaccccaagcgcgctcagggaaga
agcgaggccctgggagggaaaagcccagccagcccagggacgcagagtggccccagtgcc
aagcgggcagtatacctcaaagtggctccagctgaagaggagccgaataccagagtcacg
gggagcgtggagcccagcaaagggcatggcgggaggtcaggcagccgtcgcaatggcaga
gccagccagggcgatgtgcctacagccctgactgacctcgcaccaccactagagaaggct
gtgattatggccaaggagactgttcctgtggagatgccaccacttgctgctaccacagag
gtgttcccccaccgtgttgccacctgtgtggagaaaagagtcctgcagccaggcagccct
gtcgaagcctcacggggccgggagagtgcacctgtcttgggagagagctctaaggccatc
ccatcagccacgcgtcccctaggtagagatggagagaagagggactggtccaaggatgat
gtggctctggaagcagcagctgatgagccagagccttttgtgagcctgacctttgtcaag
aatgactcatatgagaagggcaatgatctggtggtggtgcacgtgtatgtgaaggagatt
cataaggagacttccaaggttttcttccgggagcaagacttcacactggtgttccagaca
agtgacataaacttccttcgcctccatcctggctgtgggccccacacagtgttccgatgg
caggtgaagctcaggaaccttattgaaccagaccagtgcacgtacaacttcacagcatct
cgcattgatgtctgcttgaagaaacgccatagccaacgctggggggggctggaggctcca
gccacacgaggtgcagtgggtggtgcaaaggttgccatgcctacaggccctacccctctg
gataagacccctccaggcagtaaccagcaccccttgtccagcaaagaggaagcccgaact
agtgagaaagagaagccacgtgtcgaggatgggagtctggatggcgtggcagcccgtaca
gcccaagagcatgtgacagtaaagcaagagccgcacatcccctcgcccaaaccaacctgc
atggtgccaccgatgacgcacagtccagtgagtgctgagagcgtggaagatgatgaggat
gaagatgagaagaagaaggtgtgcctgcctggcttcacagggctggtaaatctgggcaat
acctgcttcatgaacagcgtcatccagtcattgtccaacacccgggagctgcgtgattac
ttccatgatcggtccttcgagtctgaaatcaactacaacaaccctctagggacaggggga
cgcctggctatcggctttgccatgctactacgcgcactgtggaaaggcacacaccatgcc
tttcaaccctctaaattgaaggcaattgtggccagcaaggccagccagttcactggctat
gcccagcatgatgctcaagagtttatggcctttctgcttgatggcctgcatgaggatctc
aaccgcatccagaacaaaccctacacagaaactgttgactcagatgggaggcccgatgag
gtggtagctgaggaggcctggcagagacacaaaatgaggaatgattccttcattgtggac
ctattccagggccagtacaagtcaaagttggtgtgcccagtctgttccaaggtgtccatc
accttcgaccccttcctgtacctcccagtccccctcccacaaaagcagaaggtgctgact
gtctactactttgcaaaggagccgcacaagaaacccatcaagttcctcgtgagtatcagc
aaggagaactccagtgccatggaggtcctcgactcggtggcccacagtgtgcatgtgaaa
ccagacaacctgcgcctagcagaggtaatcaagaaccgcttccaacgcatgttcttgcca
tcccagtctctggacacagtctctcccacagacctgctgctctgcttcgaggtgctgtcc
ccagagctggccaaggagcgggtagtggagctgcaggtccagcagcgcccacaggtaccg
agtgtccctgttgccaagtgtgcagcctgccagaagaagcagctgtcagaagaagagaag
cttaggcgctgcacgaggtgctatcgagtcggttactgcaacgtgacgtgtcagaagaca
cactggccagaccacaaggctttgtgccgccctgagaacatcggtttccccttcctcatc
agtgtgccggaatcccgcctcacttatgcccgcctggcccagctgctggagggctatgca
aggtactccgtcagcgtgttccagcctcctttccagctgggtcggatgtcaccagagcag
ggactgcagcctctgctcctagacaagctggagcccctggccaagggcagctgtgctgct
gccacctctgctcctgagctgggggatggggacagggcttctggcctcctgcaggagcct
cccctctcaccagctgtgcctgagctgtacccagagatgagcgacactggcactgttcgg
agcaaggtcctggctgccaggagttccctgctgagcttggattcgggcttctctgagcac
atggatttgcagggcgacagctgttgcgagaaagagccgtcctatgagagagccctcaaa
ccagaagctgccatccctgggtaccagcacactccagactcgctgagcgcccgtgccacg
cagttctacatcaacaagatcgatgctgccaacaaagagtataagctggaagataaaggt
gacacccccttggagctgacagacgactgttcgcttgccctggtgtggaagaacaatgag
cgcctcaaggaatttgtattggtggagtccaaggagctggagtgtgtggaggatccgagc
tcagccagtgaagcagcccgagctggccacttcaccctggagcagtgcctcaatctcttt
accaagcccgaagtcctggccccagaggaagcgtggtactgccccaagtgcaaacagcac
cgtgaggcctccaagcaattgatgttgtggcgcctgcccaacgtcctcatcatccaactc
aagcgcttctccttccgcagctttatttggagggacaaaatcaacgatatggttgacttc
cctgtccggagcctggacctaagcaaattctgcatcggccggaagggtgagcagcagctg
cccatgtatgacctgtatgctgtaatcaatcactatggaggcatgattggcgggcactac
acggcatacgcccgcctgcccaacgacaagaacagccagcgcagtgacgtgggctggcgg
ctcttcgatgacagcacagtcaccaccgtggacgagagccaggtggtaaccagatacgcc
tatgtcctcttctaccgccggaggaactctcctgtggagagacccctgccagggcacccc
ccagaccaccgagccgagcgcaccccctctgccgaagctgctgccagtcagcactgtccc
acacgctga

DBGET integrated database retrieval system