KEGG   Gallus gallus (chicken): 100859108Help
Entry
100859108         CDS       T01006                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1
Orthology
K11867  
AMSH-like protease [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100859108 (STAMBPL1)
Peptidases [BR:gga01002]
 Metallo Peptidases
  Family M67
   100859108 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
6
AA seq 453 aa AA seqDB search
MEALEKKSDLLGLQTEGNMEQPFSISSLKKLVAIPDHTDISVTPEERVRALSKLGSNIAI
NEDITPRRYFRSGVEMERMASIYMEEGNLENAFVFYNKFITLFVEKLPSHRDYHQCAVPE
KQVIIKKLKEVAFPRTDELKRDLLKKYSLEYQEYMQNKNKCRTESLKKLEQQKLIEAEKK
RIAHMRQQQLESEQFQFFEDQLKKQELARDQKIKESMVMSEQIDGSMLSCISVPENSSSP
TTLLEKKEKSGICVSTGDSPPVNRALKPAAALSAVQTQLAEALRGVILPRDLCHKFLLLA
EANTLRGIETCGILCGKLTHNEFTITHVIVPKQSSGPDYCDMENVEELFGIQDQFDLLTL
GWIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHNDTGIFRLTNAGMLEVSACK
KKGFHPHTKDPRLFNPCTHVVGKDIKIIVLDLR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaggctttggagaaaaagagcgacctccttggtttgcaaacagagggcaacatggaa
caaccattcagtattagttccttgaaaaagctcgtagctattcctgaccacacggacatc
tctgtgaccccagaagagagagtgcgtgccttaagcaaacttggcagcaatattgcaatc
aatgaggacatcactccgcgtcgttacttcagatccggagtagaaatggagcgaatggca
tcaatatacatggaggagggaaatctggagaacgcttttgttttttataacaagttcata
accttgtttgtggagaagctgcccagtcaccgagactatcaccaatgtgcagtaccagaa
aaacaagttattattaagaaactgaaggaggttgcatttccacggacagacgaactgaag
agagatcttttaaaaaaatatagcttagaatatcaagaatacatgcaaaacaaaaacaag
tgtagaactgaatctctgaagaaactagagcagcagaagctgatagaggcagagaagaaa
cgaattgcacacatgcggcagcagcagcttgaatcagaacagtttcagttctttgaagat
cagcttaagaagcaagaactggctcgagatcagaagattaaagagagcatggttatgtct
gagcagatagatggaagtatgctatcctgcatttctgtacctgagaacagttcctcacct
accacactgctagagaaaaaagagaagagtggcatatgtgtctctactggagattcacct
ccagtaaaccgggccttaaagccagcagctgctttaagtgctgttcagactcaattggct
gaagcgctcagaggtgtaattttacccagggatctctgtcacaaatttctgctgctagca
gaggcaaatacattaagaggaatagagacatgtggaattctctgtggaaaactgacacac
aacgaatttactattacccacgtaatagtgccaaagcaatcttcaggaccagactactgt
gacatggagaacgtggaagaattatttggtattcaggatcagtttgatctcctcactttg
ggttggatacacacacatccaacacaaaccgcattcttatccagtgttgatcttcatact
cattgttcttatcagctcatgttaccagaggccattgcaattgtttgttcaccaaaacat
aatgatactggcatcttcagactgactaacgctggcatgcttgaagtttctgcttgtaaa
aagaagggatttcatccacatacaaaggatcctaggttatttaacccatgcacccatgtg
gttgggaaagacataaagataattgtgctggatctgaggtga

DBGET integrated database retrieval system