KEGG   Gallus gallus (chicken): 100859132Help
Entry
100859132         CDS       T01006                                 

Gene name
RASGRF2
Definition
Ras protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100859132 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
Z
AA seq 1238 aa AA seqDB search
MQKSVRYNEGHALYLALLARKEGTKRGYLSKRTAEANRWHEKWFALYQNVLFYFESEQSA
RPAGIYMLEGCSCERAPAPKGAAAGSAKDAALDKQYYFTVLFGHEGQKPLELRCEDEGDG
DEWVEAIHQASYSDILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKSE
IIALNKTKERMRPYQGNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESM
RKRNQIVFNMVEAESEYVHQLYVLVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMF
LHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDK
LLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEE
LSRVMHDEVSDTENIRKNLAIERTIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKVR
LGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEETDATDDDSK
STGQVFGHLDFKLVVEPTDAPPFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTIVFE
ENSKVTVPHMIKSDARLHRDDIDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDF
LNTFLHTYRIFTTAAVVLEKLSDIYRRPFTSIPVRALELFFATSQNNRGEYLADAKSPHL
CRKFSSPPPLSLSRTSSPVRTRKLSLTSPLNSRIGALDLSTSSVASSPTSTYSPATSPPP
TGSKVPLDLSKGPSSPEQSPGSIEDSLENPRIDLCNKLRRSIRRAVLESVSVDRTIPEST
SAVDTTELSPCRSPSTPRHLRYRQSGVQTADNSHCAVSPASAFAIATAAAGHGSPPGFNN
SERMCDKEFIIRRAATNRVLNVLRHWVSKHSQDFELNNELKMNVLNLLEEVLRDPDLLPQ
ERKATANILRALSQDDQDDTHLKIEDIIQMSECPKPECFETLSAMELAEQITLLDHIVFR
SIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANSIEKWVA
VADICRCMHNYNGVLEITSALNRSAIYRLKKTWAKVSKQAKALMDKLQKTVSSEGRFKNL
RETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTS
YRIEHQQKVTHYLLDKALIIDEDTLYELSLKLEPRLPA
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcggtacaacgaggggcacgccctatacctggcgctgctggcccgc
aaggagggcaccaagcgcggctacctgagcaagaggacggccgaggccaaccgctggcac
gagaagtggttcgccctctatcagaacgtcctcttctacttcgagagcgagcagagcgcc
cggcccgccggcatctacatgctggagggctgcagctgcgagcgggcgccggcccccaag
ggcgcggccgccggcagcgcgaaggacgcggcgctggacaagcagtattactttactgtt
ttgttcggccatgaagggcagaagccactggagctccgttgtgaggacgaaggtgatgga
gatgaatgggtggaagctattcaccaggctagttattcagatattctgattgaaagagaa
gtactgatgcagaagtacattcatcttgtccaaattgtagagactgaaaagattgcagcc
aatcagcttcgacatcagcttgaggatcaagacacagaaattgaaagacttaaatctgaa
attatagctctaaataaaacaaaagaaagaatgcgaccttatcaaggcaaccaggaagat
gaggatccagatattaaaaaaattaaaaaggttcagagctttatgcgaggctggttatgt
agaagaaaatggaagactattgtccaagattatatttgttctccccatgcagaaagtatg
agaaaaaggaatcagatagtttttaacatggttgaggctgaatctgaatatgtgcatcaa
ctttatgttcttgtgaactgttttctgaggcccttaagaatggctgcaagttcaaagaag
ccacctatcagtcatgatgatgtcagtagcattttcctcaatagtgaaacaatcatgttt
cttcatgaaatatttcatcaaggtttaaaagcaagaattgctaattggcctaccttaatt
ctagctgacttatttgacattctgctgccaatgctgaacatatatcaagaatttgttcgg
aatcatcagtatagtctacaagtactggcaaactgtaagcaaaacagagattttgacaaa
ctcttgaagcaatatgaagccaacccagcatgtgaggggcgaatgctggaaactttcctt
acttaccccatgtttcagattcctagatacataataacacttcatgaactcctggctcac
acaccacatgaacacgttgaacgaaaaagccttgaatttgcaaaatctaaactagaagaa
ctttcaagggtgatgcatgatgaagtgagtgacacggaaaacatccggaagaatctggcc
atagaaagaacaatagtagaaggctgtgatatattgctagatactagtcaaacttttata
cgccaaggttcccttattcaagtcccttcagttgaaaggggaaaacttagcaaagttcgt
ctgggatcattgtctttgaaaaaagaaggagaaaggcaatgcttcttatttacaaaacat
tttttaatttgtacaagaagttcaggaggaaaactgcatctacttaagacaggaggtgtt
ctgtcgttgatagagtgcacattgattgaggagacagatgcaactgatgatgactcaaaa
agcactggacaggtgtttggacaccttgatttcaagcttgtagttgaacctacagatgct
cctccttttactgttgtcctcttggctccttcacgtcaagagaaagctgcatggacaagt
gatataagtcagtgcattgataacataaggtgcaatggtttaatgaccatagtgtttgaa
gaaaattctaaagtcactgtgccacatatgataaagtctgatgcacgtcttcatagagat
gacattgatatctgcttcagcaaaactctaaattcctgcaaagtacctcaaatccgttat
gcaagtgttgaacgccttttggagaggctaacagacttgcggtttctgagcattgatttc
ctgaataccttcctgcatacttaccgcatatttactactgcagctgttgtactggaaaaa
ctttcagacatatacagacggcctttcacttccattccagttagggctttggagttattt
tttgctaccagtcagaacaacagaggagagtaccttgctgatgctaagtcaccgcatctc
tgtcgcaaattttcttctccccctccactgtcactttccagaacatcctcacctgtcaga
actcgaaaattgtcattgacttcaccactgaattcaagaattggtgcccttgatctttct
acttcatctgtggcaagcagtcctacctcaacctatagtccagccacctctcctccacca
acaggtagcaaagtacctctggaccttagcaaagggccctcctctcctgagcaaagccct
ggctccatagaggacagcttggagaaccctcgcattgacctgtgtaacaaactgaggaga
agcattcgaagagcagttctggaatcagtgtcagtggacagaactattcctgaaagcacc
tcggcagtggataccacagaactttccccgtgtagatccccttcaacaccacgtcatctc
cgctatcgtcaatcaggagtgcaaactgctgacaacagtcactgtgctgtttctcctgca
tcagcttttgctattgctacagctgcagcagggcatgggagtccgccaggttttaacaat
tctgaacgaatgtgtgacaaagagttcataatacgcagagcagccactaatcgtgtcctg
aatgtcttacgtcactgggtctccaagcactctcaggattttgaactaaacaatgagctg
aaaatgaatgtgttaaatttgctggaagaagttttgagagaccctgaccttctaccacaa
gaaaggaaagctactgcaaatatactaagggcactttctcaggacgatcaagatgatacc
catttaaaaatagaggatatcattcagatgtcagaatgtccaaaaccggagtgctttgag
actttgtctgccatggagcttgcagagcaaataactcttttagaccacatagttttcaga
agcataccctatgaagagtttcttgggcagggctggatgaaactggataaaaatgagaga
acaccctatattatgaaaactagtcaacattttaatgatatgagtaaccttgttgcctcc
caaataatgaattatgctgatgtcagctcccgggctaactcaattgaaaagtgggtagca
gtagctgatatttgtcgatgtatgcacaattacaatggtgtgttagaaatcacgtcagcc
ttgaacagaagtgcaatctacagactgaagaaaacttgggctaaggtatccaaacaggca
aaagcactcatggacaagcttcagaagactgtgtcatctgaaggaagatttaaaaatctt
agagaaacactcaaaaattgtaacccacctgctgttccataccttggaatgtatttgaca
gatctagcatttattgaagaaggaacaccaaacttcactgaggaaggccttgttaatttt
tccaagatgagaatgatctcacacattatcagggaaatacgccagttccagcagacctcc
taccgcatagaacatcagcagaaggtcactcactacttactcgacaaggcactcatcata
gatgaagatactttgtatgagctttccctgaagcttgaacccagactccccgcctga

DBGET integrated database retrieval system