KEGG   Gallus gallus (chicken): 100859211Help
Entry
100859211         CDS       T01006                                 

Gene name
USP40
Definition
ubiquitin carboxyl-terminal hydrolase 40 (EC:3.4.19.12)
Orthology
K11869  
ubiquitin carboxyl-terminal hydrolase 40 [EC:3.4.19.12]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100859211 (USP40)
Peptidases [BR:gga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100859211 (USP40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
7
AA seq 1264 aa AA seqDB search
MGDWFSLDYFVFLKVCFVFTMFGDLFEEDFSFISNNHYGKGKKSKPKDSEPPAPRDFTNL
SGIKNQGGTCYLNSLLQTLLFTPEFREALFSLGPEELGTLDDVGKPDAKVRIIPLQLQRL
FAQLLLLDQQAASTTDLTESFGWNSNEEMRQHDVQELNRILFSALETSLVGTSGHDLINR
LYHGTVVNQIVCKECKNISERQEDFLDLTVAVKGVAGLEEALWNMYVEEEYFENENLYRC
GACDKLVEASKSAKLHKLPPFLTISLLRFNFDFEKCERYKETSCYTFPIQINLRPFCEQT
EMDDSEYMYELFSVIIHKGGCYGGHYHVYIRDVDELGNWQLQEDEDRLIEDQPSRDSENT
KETENPLAVLKGILSEEECKQIPVDQLGQKFLEKIKVSWNKKYRKQYGALRKYLQNHPQI
FQFSPDENKVGLKEKYKLPFKSDFQGQAFQSPPQENGIQWNSEKAPTRLRESSAGCHWFD
LNDSKVQPIKEEDIEKQFQGKESAYMLFYRKSQLKRPPEARGNPRYRIPEHLLNEMNAAN
IELQKKRAECDSANNSIDLHLHLSTCYKFHNGALHPSLSWKESVLDLIVDRRKTLGDLRQ
SIFQMMKSWEGDMVLSSAKSLPAGLHIYQILDGDELTLDCFGLADGADIFVWNGKEVGGV
KVMAGPDHEPVLLNILRLVEYNEGGKGQHFTESQHVFPCSTKLSDLHRALAPAGGIILKN
DSGHKEAKNWEVLLEEHMKETIKTIGLTDGCSVLILDSHDQSLVNISSGNLTAFTYDISW
LQVKNFCGTDDEEKHVKITATIETVMSDIKIKAIHELQLEEELASESCLRPVSRNGKLLS
PVPEDYTVKEAELKMGSLLGLCRGKAPTATQLFLYFIIERDHYTSPEMEIVVEETASVKE
CLNLMLEKSGLSGDSWHLRRMDWCFEAGEALSQENATLKELNVCRGDTLVITEGKLPPKG
FLKIPIWWLKSSSQMKHEEKAQDQVNGLTCKMDALQVSPAGDSPEYIQADMDLCYAGITE
IASESSLEDLKMQALTLPQCPEHVIPLPTFLRAWTVESRRPGRLLRHNKQQLSEYKLGAR
VEICIEPLQKEENLGPRELLLRVQMGIPGERDYYDSVDLVWNISKECTTWALRQRVASHY
CLPVDKIEIAKYFPEKYEWLPISSWTQQISKRKRKKKQESLQSAPYHLKDGDIIGVKNLL
LDDSKDFSTVRDDFGKQKQRQLALEKKKSRQAERSQDHVLSEEKLNIKHRKPEVALSINV
GVFR
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atgggggactggttcagtttagattattttgtgtttttaaaggtctgttttgttttcacg
atgtttggggacttatttgaagaggatttttcctttatttcaaacaatcattatggaaaa
gggaagaaatcaaagcccaaagattctgagcctccagctcccagggatttcaccaatctt
agtggtatcaaaaatcaaggtgggacctgctacctcaattcccttctgcagactctgctt
ttcacaccagaattcagagaggcactgttctccctaggacccgaagaacttgggactctg
gatgatgtcggcaaaccagatgcaaaagttcggataattccattgcagcttcaacggttg
tttgcccagctcctgctcttagatcagcaggctgcatctacaacggaccttactgagagc
tttggttggaacagcaatgaggaaatgaggcagcatgatgtgcaggaactgaatcggatt
ctgttcagtgctttggagacttcccttgtggggacttcaggtcatgaccttattaatcgg
ttataccacgggactgttgtcaaccagattgtttgtaaggaatgcaagaacatcagtgag
agacaggaagatttcttagacctaacagtggcagtaaaaggtgtagctggcttggaggag
gccctgtggaacatgtatgtggaggaagaatactttgaaaatgagaacttgtatcgatgt
ggagcctgtgataagcttgttgaagcatcaaagtcggctaaactacataagttgcctccc
tttctcaccatctctctcctgaggtttaactttgactttgagaagtgtgaacgatacaag
gaaactagttgctatacctttcctatccagataaatctgaggcctttttgtgagcagact
gaaatggatgattcagagtacatgtatgagctcttctctgttattatacataaaggtggc
tgctatggaggacactatcatgtttatatcagagatgtggatgaattaggaaactggcaa
ttacaagaagatgaggataggctgattgaagatcagccttcaagagacagtgaaaatacc
aaagaaacagaaaatccattggcagtgttgaaagggattttatcagaggaagaatgtaaa
caaattcctgtggatcaattagggcagaaattcttggagaagataaaggtgtcctggaac
aagaaataccgaaaacagtacggagcattacgaaagtatttgcagaatcatccccagata
tttcagttcagtcctgatgaaaacaaagttggtttaaaggaaaaatacaagctcccattt
aagtcagattttcaaggacaagctttccaaagccctcctcaggagaatggtatccaatgg
aattcagaaaaagcacctacaaggctaagagagagttctgctggttgccattggtttgat
ctgaatgattcaaaagtccaacccatcaaagaggaggatattgagaagcaatttcagggt
aaagagagtgcctacatgctgttctatcgcaagtctcagttgaaaagacctcctgaagct
cgaggaaatccaaggtaccgaattcctgaacatcttctgaatgaaatgaatgctgctaat
atagagctgcaaaaaaagagagcggagtgcgactcagcaaacaatagcattgatttacat
ctccatttgagcacatgttataaatttcacaatggggccttgcatccttcacttagttgg
aaagagagtgttctggatctgattgttgacagaagaaaaactctaggagacctgcgacaa
tcaatattccagatgatgaagtcttgggaaggagacatggttctcagtagtgctaaatct
ttaccagcaggactgcacatttatcagatacttgatggagatgagctgacactggactgc
tttgggctggctgatggagcagacatttttgtgtggaatgggaaggaggttggtggcgtg
aaggtgatggcaggccctgatcatgaacctgttctcttaaacattcttcgtttagtggag
tataacgaaggagggaagggtcagcatttcacagaatcacagcacgttttcccgtgtagc
acaaaactcagtgatctgcacagagccttagcaccagcaggaggaataatcctaaagaat
gactcaggacataaagaagccaagaactgggaggttcttcttgaagaacatatgaaggaa
acaatcaaaaccattggtctgacagatggatgttcggtgttaatcttagacagccatgac
caaagcttggtgaatatttcaagtggtaatttgactgcttttacatatgacatcagctgg
ctccaggtgaaaaacttctgcgggacggatgatgaagagaagcatgttaaaattactgcc
actattgaaacagtgatgtcagatatcaaaattaaagcaatacatgagctacagctagag
gaggagctagcaagtgaaagctgtcttagacctgttagcagaaatgggaaacttctctct
ccagtgcctgaggattatactgtcaaggaggcagaactgaaaatgggaagcttgctagga
ctgtgtcgtggaaaagctccaactgccactcagctctttttatattttattattgaacgt
gaccactatacaagccctgagatggaaattgttgtggaagagactgcctctgtgaaagaa
tgtctaaatttaatgctggaaaaatctggattatcaggtgacagctggcatttgagaaga
atggactggtgctttgaagcaggagaagctttaagtcaggaaaatgctactctgaaggaa
cttaatgtttgcagaggagatactttggttataactgaaggaaagcttccaccgaagggt
ttcttgaaaatacctatttggtggttgaagtcttcaagccaaatgaaacatgaagagaag
gcacaagaccaggtgaatgggttgacctgtaagatggatgctttgcaagtttctcctgca
ggagattcaccagaatacatccaagcagacatggatctgtgctatgctggcattacagaa
atagcaagcgaatcttctttggaagatctgaagatgcaggctctgaccttaccacagtgc
ccggagcatgttatcccactgcccacgtttctcagagcctggacagtagaaagcaggcgc
ccaggcaggctgctacgacacaacaagcagcaactcagtgaatataagctgggtgccaga
gtggaaatctgcatagaacctttgcagaaagaagagaacttgggcccacgtgaattgctg
cttcgagtacagatgggcataccaggggaaagggactactatgactccgtggatttggtg
tggaatatctccaaagaatgcactacctgggcactgaggcaaagagtggcttctcactat
tgtctccctgtagataaaattgaaatagccaaatacttccctgaaaaatatgagtggctg
ccaatatctagctggacccagcaaatttcgaagagaaaacggaagaaaaaacaggagagt
ttacagtcagccccttatcacctgaaagatggagatatcattggggtgaagaatcttctc
cttgatgacagtaaggacttcagcacagtgagagatgattttggaaaacagaagcaaagg
cagcttgcattagaaaaaaagaaaagtcggcaagctgaacgctcccaggaccatgttctg
tctgaggaaaaactgaatattaagcatcgtaaaccagaagtggctctttccatcaatgtg
ggagttttcagatag

DBGET integrated database retrieval system