KEGG   Gallus gallus (chicken): 373899Help
Entry
373899            CDS       T01006                                 

Gene name
PDIA3, 1, 25D3-membrane-associated, 58kDa, ERp57, GRP58
Definition
protein disulfide isomerase family A, member 3 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    373899 (PDIA3)
Enzymes [BR:gga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     373899 (PDIA3)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   373899 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   373899 (PDIA3)
  Exosomal proteins of bladder cancer cells
   373899 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
10
AA seq 505 aa AA seqDB search
MSVPRPSRAALLLLVPLLALSAGASDVVELSDADFESGLAERPGLVLVEFFAPWCGHCKR
LAPEYEAAATRLKGIVPLVKVDCTANSNTCNKYGVSGYPTLKIFRDGEESGTYDGPRTAD
GIVSHLKKQAGPASVALSSVADFEKFIGDKDASVVGFFRDASGDAYSEFMKAANNLRDNY
RFAHTSEEQLVQKYEEDGEGVVLYRPSRLANKFEDSTVKYTEDKITSAKIKKFIQENIFG
ICPHMTEDNKDLIQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMIAKKFLDAGHKLSFAVA
SRKTFGHELSEFGLDNSVGEAPVVAIRTAKGDKFVMQEEFSRDGKALERFLQDYFDGNLK
KYLKSEPVPENNDGPVKVVVAENFDEIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEK
LSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFAPAGKKQSPKKYEGGREVSDFISYLKR
EATSTPVLQEEDKAKKSKKKAKEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgcctcggccgtcacgcgccgcactgctgctgctcgtcccgctcctcgccctc
tccgctggcgcctccgacgtggtggagctcagtgacgccgacttcgagagcggcctggcc
gagcgcccaggactggtgctcgtggagttcttcgcgccctggtgcgggcactgcaagcgg
ctggcgccggaatatgaggcggctgcgaccagactgaaggggatcgtcccgctcgtgaag
gttgactgtacagcaaattcaaacacctgcaacaagtatggagtcagtggatatcccacc
ctgaagatttttcgagatggcgaagagtcaggaacctatgatggacccaggacagcagat
ggaattgtcagtcatctcaagaaacaggcgggacctgcttcagtggctctcagttctgtg
gctgattttgagaagttcattggtgataaagacgcttctgtagtgggcttctttagagat
gcttctggcgatgcttattctgaattcatgaaagctgccaacaacttaagagacaactac
cgttttgcacacaccagtgaggagcagttggtgcagaagtatgaggaagatggagagggt
gtagtcctgtaccgaccttcacggctggcaaacaagtttgaggacagcactgtcaagtac
actgaagacaaaatcaccagtgcaaagatcaagaaatttatccaggagaatatctttggt
atctgtccacatatgactgaagacaacaaagacttgatccaagggaaggacttgttggtg
gcatactatgatgtggactatgagaagaatgcaaagggctccaactactggcgcaaccga
gttatgatgattgcaaagaagttcttggatgctggtcacaaactgtcatttgctgttgct
agccggaaaacctttggccatgagctgtcagaatttggtctagacaacagcgtgggtgag
gctcctgttgttgccatcagaacagctaaaggagataaatttgtcatgcaggaagaattc
tcccgtgatggaaaggctctggagagattcttgcaagattactttgatggcaacttgaaa
aagtacctgaaatcagagcctgtccctgaaaacaatgatggccctgtgaaggtggtggtt
gctgagaactttgatgaaattgttaatgcagaagacaaagatgtcctgatagagttttat
gcaccctggtgtggccattgcaagaatctggagcccaaatacaaagagttgggagagaag
ctcagtaaagatcccaatattgtcattgccaaaatggatgctacagccaatgatgtgcct
tctccatatgaagtcagaggcttccccaccatctatttcgctccagctggcaagaagcaa
agtccaaagaagtatgagggtggcagagaagtgagtgacttcatcagctacttgaagcgg
gaggcaaccagcactcctgtgctgcaggaggaagataaagccaagaaatccaagaagaag
gcaaaggaggatttgtaa

DBGET integrated database retrieval system