KEGG   Gallus gallus (chicken): 373919Help
Entry
373919            CDS       T01006                                 

Gene name
RUNX2
Definition
runt-related transcription factor 2
Orthology
K09278  
runt-related transcription factor 2
Organism
gga  Gallus gallus (chicken)
Brite
Transcription factors [BR:gga03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Runt
    373919 (RUNX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
3
AA seq 472 aa AA seqDB search
MASNSLFSSVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSEVSPVVVAQQQQQQQQQQQQ
EAAVPRLRPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGE
VPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVLTNP
PQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFPERLSDLGRIPHPSMRVGVPTQSPR
PSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGT
GLPAITDVPRRLSGASELGPFSDPRQFTSISSLTESRFSNPRMHYPATFTYTPPVTSGMS
LGMSATTHYHTYLPPPYPGSSQNQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRM
LPPCTTTSNGSTLLNPNLPNQSDGVEADGSHSSSPTVLNSSGRMDESVWRPY
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaacagcctcttcagctccgtgacaccatgtcagcaaaacttcttttgggat
cccagcaccagccggaggttcagccccccctccagcagcctgcagcccggcaagatgagc
gaggtcagcccggtcgtagtggcccaacagcagcagcagcagcaacagcaacagcagcaa
gaagccgccgtgccccggctgcggccgcacgataaccgcaccatggtggagatcatcgcc
gaccacccggccgagttggtccgcaccgacagccccaacttcctgtgctccgtgctgccc
tcgcactggcgctgcaataagaccctcccggtggccttcaaggtggtggccttaggagaa
gtgcccgatgggaccgtggtcaccgtgatggctgggaacgacgagaactactccgcggag
ctgcgaaatgcttctgctgtgatgaagaaccaggtggccagattcaatgacctgcgattc
gtgggcaggagtggcagagggaagagctttactttgacaataactgtcctgacaaatccc
ccccaagtcgctacataccacagagccataaaggtgacggtggatgggccgagggagcca
agaaggcacagacagaagcttgatgactctaaacctagtttgttccctgaacgcctcagt
gatttagggcgcattcctcatcccagtatgagagtaggggtcccgacccagagcccacgg
ccctctctgaactctgcaccaagtccttttaatccacaaggacagagtcagattacagac
cccaggcaggcgcagtcgtccccgccgtggtcctatgatcagtcgtacccgtcctacttg
agccagatgacttcgccgtccattcactccacgactcccctgtcctccacccgaggcaca
ggacttccagccatcaccgacgtgccccgacgcctctcaggtgcttccgagctgggccca
ttttcagatcccaggcagttcacaagcatttcatccctcactgagagccgcttctccaac
ccacgaatgcactatccagccacctttacctatacaccgcccgtcacctcaggcatgtca
ctgggtatgtccgcaaccactcactaccacacctacctgccaccaccctaccccggctcc
tcccaaaaccaaagtggacctttccagaccagcagcactccatatctctactatggcact
tcgtcgggatcgtaccagttccccatggtgccgggaggggaccgctccccttccaggatg
cttcctccgtgcaccaccacgtccaacggcagcacgctgctaaacccaaacttgcccaac
cagagtgacggtgtggaggcggatggcagccacagcagctccccaactgttttgaattct
agtggcaggatggatgagtccgtttggaggccgtactga

DBGET integrated database retrieval system