KEGG   Gallus gallus (chicken): 373920Help
Entry
373920            CDS       T01006                                 

Gene name
MID1
Definition
(RefSeq) midline 1
  KO
K08285  
midline 1 [EC:2.3.2.27]
Organism
gga  Gallus gallus (chicken)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    373920 (MID1)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     373920 (MID1)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    373920 (MID1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
1
AA seq 667 aa AA seqDB search
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCASNEPVESITAFQCPTCR
YVITLSQRGLEGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAFDSNSMSSCEKVLCQ
FCDQDPAQEAVKTCVTCEVSYCEECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVTDDQLICALCKLVGRHREHQVAALSERYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEVNASRQETKLMEECDQLIEIIQQRRQIIGTKIKEGKVVRLRKLAQQIA
NCKQCIERSTSLISQAEQSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFTREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVVSLCNSADSWMIVPNIKQNHYTVHGLQSGTKYIFIVKAINQAGSRSSEPGKLK
TNSQPFKLDPKSAHRKLKVSHDNLTVERDETSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGISYKSAPKHEWIGKNSASWVLCRCNNTWVVRHNSKEIPIEPAPH
LRRVGILLDYDNGSLAFYDALNSLHLYTFDITFGQPVCPTFTVWNKCLTIITGLPIPDHL
DSSEQLA
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggaaacactggagtcggaactgacctgccctatctgtctcgagctgtttgaggacccg
ctgctgctgccctgcgctcacagtctctgcttcaactgcgcgcaccgcatcctggtctcc
cactgcgcctccaacgagccggtggagtctatcaccgccttccagtgccccacctgccgc
tatgtcatcaccctcagccagcgcggtctagaggggctcaagcgcaacgtcaccctgcag
aacatcatcgaccgctttcagaaagcctcggtgagcgggcccaactcccccagcgagacc
cgtcgggagcgggcattcgacagcaacagcatgtcctcctgcgagaaggtcctctgccag
ttctgcgaccaggaccctgcccaggaggcagtgaagacgtgcgtgacctgcgaggtctcc
tactgcgaggagtgcctgaaagccacgcaccccaacaagaagcctttcaccggccatcgg
ctgatcgagcccatcccggactctcacatcaggggattaatgtgcttggagcacgaggac
gagaaggtgaacatgtactgcgtgacagatgaccagctgatttgcgccctgtgcaagctg
gtcgggcggcaccgggaacatcaagtggcagctctaagcgagcgctacgacaagctgaag
caaaatttggagagtaacctcaccaaccttattaagaggaatactgaactggaaactctt
ctggcaaaactcattcagacctgtcaacatgtagaagtaaatgcatctcgccaagaaacc
aagctgatggaagaatgtgaccagctcattgaaataatacaacagagacgacaaataatt
ggaaccaaaatcaaggaaggaaaggtggtgaggttgagaaaactggctcagcagattgca
aactgcaagcagtgcatcgagcgctcgacatccctcatctctcaggctgagcagtcgctg
aaggagaatgatcatgctcgcttcctgcaaactgctaaaaacatcaccgaaagggtttcc
atggcaactgcatcctcccaggttctaattcctgaaattaatctcaacgatacttttgat
actttcgcacttgattttaccagggagaagaaattgttggaatgccttgattatcttaca
gctcccaaccctcccaccattcgagaagagctctgtacagcttcttatgatactattact
gtccactggacatcagacgatgagttcagcgtggtctcttacgagctgcagtacaccatc
ttcactggacaagctaacgttgttagtttatgtaactcagccgacagctggatgattgtt
cccaatatcaaacaaaaccactacaccgtgcatgggttacagagtggcacaaagtacatc
ttcattgttaaggctattaatcaggctggcagcagaagcagcgagccaggcaagctcaag
acaaacagtcagccatttaaactggaccccaaatctgctcatagaaagctgaaagtgtct
catgacaacttgacagtggaacgtgatgaaacctcctccaaaaagagtcatacaccagag
cgattcacgagccaagggagctacggagtagctggcaatgtattcattgacagtggacgg
cattactgggaagtggttataagtgggagtacatggtatgccattggtatttcatacaag
tcagcaccgaagcatgagtggatcgggaagaactcagcctcctgggtgctgtgccgctgc
aacaacacatgggtggtgagacacaacagcaaagaaatcccaatagagcctgcgcctcat
ctccgccgtgtcggcattttgctggactacgacaatggttcccttgctttttatgatgcc
ttgaactccctgcacctttacacctttgacattacgtttgggcagcccgtctgccccaca
ttcactgtgtggaataagtgtttgaccattataacaggcttgcccatccctgatcactta
gattcctctgagcagctggcatga

DBGET integrated database retrieval system