KEGG   Gallus gallus (chicken): 373954Help
Entry
373954            CDS       T01006                                 

Gene name
BCL2L1, BCL2L, Bcl-xl, bcl-x
Definition
(RefSeq) BCL2 like 1
  KO
K04570  
Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
gga  Gallus gallus (chicken)
Pathway
Apoptosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    373954 (BCL2L1)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     373954 (BCL2L1)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    373954 (BCL2L1)
Transporters [BR:gga02000]
 Other Transporters
  Pores ion channels [TC:1]
   373954 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
20
AA seq 229 aa AA seqDB search
MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHV
VNGATVHRSSLEVHEIVRASDVRQALRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFE
QVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRIVSWMTTYLTDHLDPWIQE
NGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcagtaaccgggagttagtgattgactttgtttcctacaagctctcgcagagg
gggcactgctggagcgagctggaggaagaggatgagaacaggactgacactgcagctgag
gcagagatggacagcgtcctcaatgggagcccatcctggcacccccctgccggccacgta
gtgaacggagccaccgtgcaccggagcagcctggaagttcatgaaattgttcgagcatcc
gacgtgaggcaggcgctgagagatgcgggggatgagtttgagctgaggtaccggagggct
ttcagcgacctcacctcccagctccacatcacccctggcacggcgtaccagagctttgag
caggtagtgaatgaactcttccatgatggtgtgaactgggggcgcatcgtggctttcttc
tccttcggaggggctttgtgcgtggagagcgtggacaaggagatgcgggtactggtggga
cgcattgtgtcttggatgaccacgtacttgaccgaccatctagatccctggatccaggag
aatggcggctgggagcgctttgtggatctgtatgggaacaacgctgctgccgagctgagg
aagggccaggagaccttcaacaaatggctcctcaccggggcgaccgtggccggagtgctt
ctgctgggatccctgctgagccgcaagtga

DBGET integrated database retrieval system