KEGG   Gallus gallus (chicken): 373954Help
Entry
373954            CDS       T01006                                 

Gene name
BCL2L1, BCL2L, Bcl-xl, bcl-x
Definition
BCL2-like 1
Orthology
K04570  
BCL2-like 1 (apoptosis regulator Bcl-X)
Organism
gga  Gallus gallus (chicken)
Pathway
Apoptosis
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:gga04630]
Cellular Processes; Cell growth and death; Apoptosis [PATH:gga04210]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
20
AA seq 229 aa AA seqDB search
MSSSNRELVIDFVSYKLSQRGHCWSELEEEDENRTDTAAEAEMDSVLNGSPSWHPPAGHV
VNGATVHRSSLEVHEIVRASDVRQALRDAGDEFELRYRRAFSDLTSQLHITPGTAYQSFE
QVVNELFHDGVNWGRIVAFFSFGGALCVESVDKEMRVLVGRIVSWMTTYLTDHLDPWIQE
NGGWERFVDLYGNNAAAELRKGQETFNKWLLTGATVAGVLLLGSLLSRK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcagtaaccgggagttagtgattgactttgtttcctacaagctctcgcagagg
gggcactgctggagcgagctggaggaagaggatgagaacaggactgacactgcagctgag
gcagagatggacagcgtcctcaatgggagcccatcctggcacccccctgccggccacgta
gtgaacggagccaccgtgcaccggagcagcctggaagttcatgaaattgttcgagcatcc
gacgtgaggcaggcgctgagagatgcgggggatgagtttgagctgaggtaccggagggct
ttcagcgacctcacctcccagctccacatcacccctggcacggcgtaccagagctttgag
caggtagtgaatgaactcttccatgatggtgtgaactgggggcgcatcgtggctttcttc
tccttcggaggggctttgtgcgtggagagcgtggacaaggagatgcgggtactggtggga
cgcattgtgtcttggatgaccacgtacttgaccgaccatctagatccctggatccaggag
aatggcggctgggagcgctttgtggatctgtatgggaacaacgctgctgccgagctgagg
aagggccaggagaccttcaacaaatggctcctcaccggggcgaccgtggccggagtgctt
ctgctgggatccctgctgagccgcaagtga

DBGET integrated database retrieval system