KEGG   Gallus gallus (chicken): 373980Help
Entry
373980            CDS       T01006                                 

Gene name
LAMB2
Definition
(RefSeq) laminin, beta 2 (laminin S)
  KO
K06243  
laminin, beta 2
Organism
gga  Gallus gallus (chicken)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    373980 (LAMB2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    373980 (LAMB2)
Cell adhesion molecules and their ligands [BR:gga04516]
 1. Immunoglobulin Superfamily
  Others
   LU; Lutheran blood group glycoprotein [KO:K06578]
    Laminin-11 Extracellular matrix (ECM) components
     373980 (LAMB2)
    Laminin-14 Extracellular matrix (ECM) components
     373980 (LAMB2)
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      373980 (LAMB2)
   VLA-6
      373980 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
12
AA seq 1792 aa AA seqDB search
MRGPAALLPPLLLPLLSLLVPLPSGPGGTAWAASSPDSPQGCARGSCYPATGDLLVGRAP
RLSASSTCGLRRPQPYCIVSHLQEEKKCFICDSRRPYDARSNTDSHRIENVLTTFAPRPK
KAWWQAENGVEHVSIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRSWKVYRYFAY
DCAASFPHVPRGPPRRIDDVICESRYSDIEPSTEGEVIYRVLDPAIPIRDPYSPAIQDLL
RVTNLRVNLTKLHTLGDNLLDSRREIREKYYYALYEMVLRGNCFCYGHASECAPLSGATA
TADGMVHGRCVCKHHTQGLNCERCEDFYHELPWRPAEGSSTNACRRCDCNEHSRRCHFDM
AVFLATGNTSGAVCDGCQHNTMGRRCHLCKPFYYKDPSKDLRDPAVCRACNCDPEGTVDG
GLCDGADDPERGLIAGQCRCKEHVQGPRCDRCKAGFFGLSAANPQGCQRCRCDPRGTVAD
GSQCDPISGDCLCKRLVTGRSCDQCLPEHWALSHDLPGCQPCECDVGGAHDNQCAMETGQ
CRCRSHIVGRQCEQVEPGFYRINLDHYTYEAEDARLHMGSVVQREPHAGHLASWTGSGFA
RMQEGGWVEFHVSDVPFSMEYDVIIRYEPQHPEPWKEVRMQVLRPSPVSASSPCGNTIPA
DDQLSTSLLSGARYVVLPRPICLERGVSYTIRLELGCATGQQDPTASVLIDSLVLLPRYS
SMEMFIAGDPAAMGRRETFERYRCAQHFHTVVLSPVAEPCSRLLHSLSAILHNGALPCLC
DPQGLLSAECQPQGGQCRCKPNVVGRRCHRCSPGTFGFGPGGCRPCQCSGEGSLSAVCDT
ITGQCPCRQGAHGSRCDRCQPGHWGFPTCRPCQCNGHAEECDPQTGSCLRCRDHTDGERC
QRCAAGHFGNPALGSGQHCRPCPCPDGPGGPRHFAASCYQDGRSRQVVCHCSPGYTGPRC
DECAPGYYGDPLQPGGHCRPCQCHNNIDTTDPEACDRRTGQCLRCLYNTAGPHCAECQPG
YYGDAMRHSCRRCSCNTLGTDPNTCGPQQCQCDQRSGQCHCLPHVEGQSCDRCSPNFWNL
GSGQGCEPCACHPQHSLSPACNQFTGQCSCRPGFGGRTCANCQEQHWGDPRLQCRACDCD
PRGIASTQCHHGSGHCDCRPGISGVRCDQCARGFSGTFPACQPCHPCFGDWDRVVQDLAS
RTRALEQRASLLQHTGAAGAFEGTFRRLEESLATIRDAVAARNATAATATFLTRATEGLR
QQIGEATEKLTRLESELTVAQDANFNASHVLGMVDRGARTLNHSLRELEQRLHALKTSNF
LGAFDSIRQSHWESQDAERRADASTRVVPSPVSASSATRHHTEQLLASRRDAFNRQNAAS
RRALTELAARARELSLQPVNKKVCGAAGDVPCAESPCGGAGCRDEDGARRCGGLSCSGAV
STADSALDRARHAQEELRRAAGEVAQLSHRVAEAKGKADEARLQAQAALDKANQTRARVE
HSNKELRELISHVKAFLSQEGADPESIEVVASRVLELSLPASPAQIHRLAEEIKARVRSL
ASVDAILEQTAGDVRQAGQLLQDAQRAKARAEGVRGTAEAVQQALEEARQAQGAAGQALH
STAADIQHSEHTIGTMRAQTLGAEQQLAAATERLGLLEGQTDALKVKRANNSLAATRAHD
AAGIARDRASEAKQVLEGPLKDRYRAAQELVQHRAQGAQQAGGRAQQLREEAAGLLQDAQ
GKLQKLRALEEAYERNERVLDAKVAQLDGLEARMREVLATINQQVQIYNTCQ
NT seq 5379 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggccccgcagccctcctccccccgctccttctccccctcctctccctcctcgtc
ccgctgccgtccgggccgggagggaccgcgtgggccgcgtcttctcccgactccccccag
ggctgcgcccgcggcagctgctacccggccaccggggacctgctggtggggagagccccg
cggctcagcgcctcgtccacctgcgggctgcggcggccccaaccctactgcatcgtcagc
cacctccaggaggagaagaagtgcttcatctgtgactcgcggagaccctacgacgcccgc
agcaatactgacagccaccgcatcgagaacgtgctgaccacctttgccccccgccccaag
aaggcctggtggcaggcggagaacggcgtggagcacgtcagcatccagctggacctcgag
gctgagttccacttcacccacctcatcatgaccttcaagaccttccgccccgcagccatg
ctggtggagcgctcggccgacttcggccgcagctggaaggtgtaccgctacttcgcctac
gactgtgctgcgtccttcccccacgtcccccgtgggcccccgcgccgcattgacgacgtg
atctgcgagtcgcgctactccgacatcgagccctccaccgagggagaggtgatctaccgc
gtgctggaccccgccatccccatccgggacccctacagccccgctatccaggatctgctg
cgcgtcaccaacctgagggtgaacctcaccaagctgcacacgctgggggataacctgctg
gactcacggcgggagatccgcgagaagtactactatgcgctgtatgagatggtgctgcgc
ggaaactgcttctgctacgggcatgcctcggagtgtgcaccactcagcggggccaccgcc
actgcagatggcatggtgcacgggcgctgtgtctgcaagcaccacacgcaggggctgaac
tgtgagcgctgcgaggacttctaccacgagctgccctggcgcccggctgagggctccagc
accaacgcctgccgccggtgcgactgcaacgagcactcacggcgctgccacttcgacatg
gccgtgttcctggccaccgggaataccagcggggccgtgtgcgacggctgccagcacaac
accatggggcgccgctgccacctctgcaagcccttctactacaaggatcccagcaaggac
cttcgggatccagccgtgtgccgagcctgcaactgcgaccctgagggcaccgtggacgga
gggctgtgtgacggtgccgatgacccggagcgggggctgatcgcggggcagtgccgctgc
aaggagcatgtgcagggccctcgctgcgaccgctgcaaagccggcttcttcgggctcagt
gctgccaacccgcagggctgccagcggtgtcggtgtgacccccgcggcacggtggccgat
ggcagccagtgtgaccccatcagcggtgactgcctctgcaagcggctggtgaccgggcgc
agctgcgaccagtgtctgcctgaacactgggctctcagccacgatctccctggctgccag
ccttgtgagtgtgacgtgggaggtgcccacgacaaccagtgtgccatggagacggggcag
tgccggtgccgcagccacatagtgggacggcagtgcgagcaggtggagcccggcttctac
cgcatcaacctggaccactacacctacgaggccgaggatgcccggctgcacatgggctcg
gtggtgcagcgcgagcctcacgcaggtcacctggcctcctggacagggtcaggctttgcc
cgcatgcaggagggcggctgggtagagttccacgtgagcgacgtgcccttctccatggaa
tacgatgtcatcatccgctacgagccccagcacccggagccctggaaagaggtgaggatg
caggtgctgcgccccagccccgtgtctgccagcagcccgtgcgggaacaccatcccagcc
gacgaccagctctccaccagcctcctgtctggcgctaggtacgtggtgctgccccgtccc
atctgcctggagcgaggggtctcctacaccatccgcctggagctgggctgtgccacaggg
cagcaggaccccaccgccagcgtgctcatcgattcgctggtgctcctcccccgttattcc
tccatggaaatgttcatcgcgggtgaccctgctgctatgggacgtcgggagaccttcgag
aggtaccgctgcgctcagcatttccacactgtggtgctgtcgccagtggccgagccctgc
tcccggctcctgcacagcctctcagccatcctgcacaatggggcactgccctgcctctgc
gacccgcagggcttgctcagcgccgagtgccaaccccagggcgggcagtgccgctgcaag
cccaacgtcgtgggacggcgctgccaccgctgctccccgggcaccttcggcttcgggccc
ggcgggtgccgaccctgccagtgcagtggtgagggatcgctgagtgccgtgtgcgacacc
atcacagggcagtgcccctgccgccagggtgcccacggctcacgctgcgaccgctgccag
ccgggccactggggcttccccacctgccggccctgccagtgcaacgggcacgccgaggag
tgcgacccacagacgggcagctgcctgcgctgccgcgaccacacggacggcgagaggtgc
cagcggtgtgcggccgggcactttgggaaccctgcgctgggctccggccagcactgccgg
ccctgcccctgccccgacggacccggtggcccccggcactttgctgcctcctgctaccag
gatgggcgctcccggcaggttgtctgccactgcagccccgggtacacaggtccccgctgt
gacgagtgtgcgcccgggtactacggggaccctctgcaacccggcgggcactgccggccc
tgccagtgccacaataacatcgatacgactgacccagaggcgtgtgaccggcgcacgggg
cagtgcctgcgatgcctctacaacacggcagggccacactgtgccgagtgccagcctggg
tactatggggatgccatgcggcacagctgcaggcgttgctcctgcaacacactgggcacc
gaccccaacacctgcgggccacagcagtgccagtgcgaccaacgcagcgggcagtgccac
tgcctgccccacgtggagggacagagctgtgaccgctgcagccccaacttctggaacctg
ggcagtgggcagggctgcgagccctgtgcctgccacccccagcactccttgtcgcctgca
tgcaaccagttcacagggcagtgctcgtgccggccaggcttcgggggccggacctgtgcc
aactgccaggagcagcactggggtgacccacggctgcagtgccgagcctgcgactgtgac
ccccgcggcatcgccagcacccagtgccatcatggcagtgggcactgcgactgccggccc
ggcatctcaggcgtccgctgcgaccagtgcgcccggggcttttctggcaccttcccggcc
tgccagccttgccacccctgctttggggactgggaccgcgtggtgcaggacctggcctcc
cgcacccgggctctggagcagcgggccagcctcctgcagcacaccggagctgccggtgcc
ttcgagggcaccttccggcggctggaggagagcctggccaccatacgtgatgcagtggct
gcccgcaatgccaccgccgccactgccacgttcctgacacgtgccacagaggggttgcgg
cagcagatcggggaagccactgagaagctgacacggctggagagtgagctgacggtggca
caggatgccaatttcaacgccagccacgtgctgggcatggtggaccggggggcccgcacc
ctcaaccacagcctacgtgagctggagcagcggctgcatgcactcaagacctcaaatttc
cttggtgccttcgacagcatccgccagtcccactgggaatcgcaggatgctgagcgccga
gcggatgcctccacccgtgtcgtacccagccctgtcagtgcttcatcagccacgcggcac
cacaccgagcagctcctggccagcaggagggatgccttcaaccggcagaacgcagccagc
cggcgagcgctgacggagctggcggccagggcgcgggagctgagcctgcagccggtcaac
aagaaggtgtgcggcgctgctggggatgtgccctgtgctgagagcccctgcggaggagcc
ggctgccgggatgaggacggggcacgacgctgcggagggctgagctgcagcggcgccgtc
tccaccgctgacagtgcgctggaccgtgcacggcacgcacaggaggagctgcggcgggcg
gctggcgaagtggcccagctctcccatagggtggctgaggccaaggggaaggcggacgag
gctcggctgcaggcgcaggcagccctggacaaggctaaccagaccagggcccgtgtggag
cactccaacaaggagctgcgggagctcatcagccacgtcaaggccttcctgagccaggag
ggcgctgatcccgagagcattgaggtggtggccagccgcgtgctggagctgtctctgcct
gcctcgccggcccagatccaccgcctggccgaggagatcaaggcgcgggtgcgcagcctg
gccagtgtggacgccatcctcgagcagacagctggcgacgtgcgccaggctgggcagctg
ctgcaggatgcccagcgggccaaggcacgggcggagggcgtgcggggcacagctgaagca
gtgcagcaggcactggaggaggcgcggcaagcacagggcgcagccgggcaggcgctgcac
agcactgctgctgacatccagcacagcgagcacaccatcggcacgatgcgggcgcagacg
ctgggtgcggagcagcagctggctgccgccacggagcggctcggtctcctggagggacag
acggacgccctgaaggtgaagcgtgccaacaacagcctggcggccacgcgtgcccatgac
gcggctggcatcgcgcgggaccgtgccagtgaagccaagcaggtgctggaggggccgctg
aaggaccggtaccgggcagcccaggagctggtgcagcaccgggcgcagggagcgcagcag
gcaggcggccgggcccagcagctgcgcgaggaggccgccgggctgctgcaggatgcccag
ggcaagctgcagaagctgcgagcgctggaggaggcgtatgagcggaacgagcgggtgctg
gacgccaaggtggcccagctggatgggttggaggccaggatgagggaggtgctggccacc
atcaaccagcaggtccagatctacaacacctgccagtga

DBGET integrated database retrieval system