KEGG   Gallus gallus (chicken): 373987Help
Entry
373987            CDS       T01006                                 

Gene name
THBS1, thrombospondin-1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
gga  Gallus gallus (chicken)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    373987 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    373987 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    373987 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    373987 (THBS1)
  Cellular commiunity
   04510 Focal adhesion
    373987 (THBS1)
Heparan sulfate/heparin binding proteins [BR:gga00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  373987 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
5
AA seq 1175 aa AA seqDB search
MGPAAVVVLLLLALGGPEAKRTAESRGDDDSVFDIFELTVRKGAGRRAPGVHLVKGPDTS
SPAYRIEDASRIPAVSDSKFQDLLDIIHAEKGFILQATLRQAKKSRGTLLAVERKDGSGH
VFSLVSNGKAGTLDLSLSGDGKQQLVSVEDALLATGHWKNITLFVQEDRAQLYVGCEKME
NAELDIPIQNIFTRDLASSARLRIAKGGVNDNFQGLLQNVRFVFRTTLETIMRNKGCSSS
TSAIITLDKPMNGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMVTTLQD
RVRKVTEENELIAKVVQITPGVCIHNGILHKNKEEWTIDSCTECTCQNSATICRKVSCPL
MPCSNATVPDGECCPRCWPSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEG
SSVQTRTCHLQECDKRFKQDGGWSHWSPWSSCSVTCGTGMITRIRLCNSPVPQLNGKPCE
GEARETKSCQKDPCPINGNWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYGGKACVGEA
KGTQVCNKQDCPVDGCLSNPCFAGTTCTSSPDGSWKCGACPAGYHGNGIHCQDIDECKEV
PDACFVFNGVHRCENTEPGYNCLPCPPHFTGSQPFGRSVEDATANKQVCKPRNPCTDGTH
DCNKNAKCNYLGHFSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKK
DNCPNLPNSGQEDYDKDGIGDACDNDDDDDGIPDDRDNCPFIYNPQQYDYDRDDVGDRCD
NCPYNHNPDQIDTDNNGEGDACAVDIDGDGVLNERDNCQYVYNVDQRDTDLDGVGDQCDN
CPLEHNPDQEDTDSDLIGDECDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACD
HDDDNDGIPDDKDNCRLVANPDQADSDGDGRGDACKDDFDQDSVPDIDDICPENVEISET
DFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFFVN
TERDDDYAGFVFGYQSSSRFYVVMWKQITQSYWDSTPTKAQGYSGLSIKVVNSTTGPGEH
LRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADS
GPIYDKTYAGGRLGLFDFSQEMVFFSDLKYECRDP
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atggggccagccgctgttgtcgtcctcctcctcctggcgctcggcggcccggaagccaaa
cgcacggcagagtccaggggtgatgatgacagcgtctttgatatctttgaactcactgtt
cgcaagggagctgggcgccgggcacctggggtgcacctggtgaaggggccggacacctcc
agccctgcttaccgcatcgaagatgccagtcgcatccctgccgtctctgactccaagttc
caagacttgttagatatcatccatgctgagaagggcttcatccttcaggccactctgcgg
caagccaagaagagcagaggcacactgctggctgtggaacggaaagatggctctggtcac
gttttcagcctagtttcaaatggcaaggcaggcaccttggacctgagcctctctggtgat
ggcaagcagcagttagtgtctgtagaggatgccttgttagctacgggacactggaagaac
atcaccttgtttgtgcaagaagaccgtgctcagctttacgtggggtgtgagaaaatggag
aatgctgaactggacattcccatccaaaacatcttcacaagggacctggccagcagtgcc
aggctccgtattgctaaagggggagtcaatgacaacttccagggactgttgcagaatgtg
cggtttgtgtttagaacgactctggaaactatcatgaggaacaaaggctgctccagctct
actagtgcaatcattactttggacaaacccatgaatggttccagcccagctatccgcacc
aattacattggccataaaacaaaggatattcaagcagtctgtggcttttcctgtgatgaa
ctaactaacatgtttgtggaactgcaagggctacggtccatggttacaacacttcaagac
agagttcgcaaagtgactgaagaaaatgaactgattgccaaagtggtccagatcactccc
ggagtatgcattcataatgggatcttgcacaaaaataaggaagagtggactattgacagc
tgcactgaatgtacttgccagaactctgccactatatgccggaaagtgtcttgccctctc
atgccctgttccaatgccactgtgcctgatggggagtgctgcccccgatgctggcctagt
gactatgcagatgatggatggtctccttggtctgaatggacttcatgttcagtgacctgt
gggaatggaattcagcagagagggcgttcctgtgacagtctcaacaatcgctgtgaaggg
tcttctgtgcagactcggacttgccaccttcaggagtgtgataagagatttaaacaagat
ggtggttggagccactggtcaccgtggtcatcatgttcagtcacctgtggtacaggcatg
atcactagaattcgtctctgcaactctccagtaccacagctgaatggcaagccttgtgag
ggtgaagcaagagaaaccaagtcttgccagaaagatccttgcccaattaatggcaactgg
ggaccatggtctccgtgggatgcttgcacagtgacgtgtggaggaggacttcagaaacgc
agccgtctctgtaataatcctgagcctcaatatggtgggaaggcttgtgtaggtgaagct
aaaggaactcaggtctgcaacaaacaggactgtccagttgatgggtgtctgtctaatccc
tgctttgcgggaactacatgtacaagctcccctgatggttcttggaagtgcggtgcctgt
cctgctggctaccatggtaatggtatccactgccaagatattgatgagtgcaaagaggtt
cctgatgcctgctttgtcttcaatggagtgcacaggtgtgagaatactgaacctggatac
aactgtctgccttgtccaccacatttcactgggtcacagccatttggtcgcagtgttgag
gatgccacggcaaacaaacaggtctgcaagccacgtaatccatgcacggatggaacacat
gattgcaacaagaatgccaaatgcaattaccttggccacttcagtgacccaatgtatcgt
tgtgaatgtaaaccaggctatgctggcaatggcataatctgtggagaagatactgacttg
gatggatggccaaatgagaaccttgtctgtgttgccaatgccacttaccactgtaaaaaa
gataactgccccaatctccccaactctgggcaggaagactatgataaagatgggattggt
gatgcctgtgataatgacgatgatgatgatggtattcctgatgacagggacaactgccca
ttcatctacaacccacagcagtatgactatgacagggatgatgttggtgaccgttgtgat
aactgcccctacaatcacaaccctgatcagattgacactgacaacaacggagaaggagat
gcatgtgcagtggatattgatggagatggtgtcctcaacgaaagggacaactgccaatat
gtctacaatgtagaccagagggacacagatttggatggtgttggagatcagtgtgataac
tgtccactggaacataatccggaccaggaagatactgactctgaccttataggtgatgaa
tgtgataacaaccaggatatagatgaagatggtcatcaaaataatcttgataattgccct
tatgtgcccaatgccaatcaagctgatcatgacaaggatggaaaaggtgatgcctgtgac
catgatgatgacaatgatggtattcctgatgacaaagataactgcagattggttgccaac
ccagatcaagcggattctgatggtgatggacgtggagatgcttgcaaagatgactttgac
caagacagtgtgccagacattgatgacatctgccctgaaaatgtggaaatcagtgagact
gacttcagaaggtttcagatgattcccttggatccaaaaggaacatcccaaaatgatcca
aactgggttgtgcgtcaccagggtaaagaactggttcagacagtcaactgtgaccctggc
cttgcagttggttttgatgaattcaatgctgtggacttcagtggcaccttctttgtcaat
acagaaagggatgatgattatgctggctttgtgtttggctaccagtctagcagtcgtttc
tacgttgtcatgtggaaacagatcactcagtcttactgggactccacaccaaccaaagct
caaggctactcaggtctctccatcaaggttgtgaattccaccacaggtccaggagaacac
cttcgtaatgctctgtggcacacaggaaacactcctggccaggtgagaactttgtggcat
gaccctcgccacataggctggaaagacttcactgcatacagatggcgccttagccataga
ccaaagactggctacatcagagttgtaatgtatgaggggaagaaaatcatggcagactca
ggaccaatctatgataaaacttatgctggtggtcgtctaggattatttgacttctctcaa
gaaatggtgttcttctcagatcttaaatatgaatgcagagatccataa

DBGET integrated database retrieval system