KEGG   Gallus gallus (chicken): 373987Help
Entry
373987            CDS       T01006                                 

Gene name
THBS1, thrombospondin-1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
gga  Gallus gallus (chicken)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:gga04350]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:gga04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:gga04145]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:gga04115]
Cellular Processes; Cell communication; Focal adhesion [PATH:gga04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
5
AA seq 1175 aa AA seqDB search
MGPAAVVVLLLLALGGPEAKRTAESRGDDDSVFDIFELTVRKGAGRRAPGVHLVKGPDTS
SPAYRIEDASRIPAVSDSKFQDLLDIIHAEKGFILQATLRQAKKSRGTLLAVERKDGSGH
VFSLVSNGKAGTLDLSLSGDGKQQLVSVEDALLATGHWKNITLFVQEDRAQLYVGCEKME
NAELDIPIQNIFTRDLASSARLRIAKGGVNDNFQGLLQNVRFVFRTTLETIMRNKGCSSS
TSAIITLDKPMNGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMVTTLQD
RVRKVTEENELIAKVVQITPGVCIHNGILHKNKEEWTIDSCTECTCQNSATICRKVSCPL
MPCSNATVPDGECCPRCWPSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEG
SSVQTRTCHLQECDKRFKQDGGWSHWSPWSSCSVTCGTGMITRIRLCNSPVPQLNGKPCE
GEARETKSCQKDPCPINGNWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYGGKACVGEA
KGTQVCNKQDCPVDGCLSNPCFAGTTCTSSPDGSWKCGACPAGYHGNGIHCQDIDECKEV
PDACFVFNGVHRCENTEPGYNCLPCPPHFTGSQPFGRSVEDATANKQVCKPRNPCTDGTH
DCNKNAKCNYLGHFSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKK
DNCPNLPNSGQEDYDKDGIGDACDNDDDDDGIPDDRDNCPFIYNPQQYDYDRDDVGDRCD
NCPYNHNPDQIDTDNNGEGDACAVDIDGDGVLNERDNCQYVYNVDQRDTDLDGVGDQCDN
CPLEHNPDQEDTDSDLIGDECDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACD
HDDDNDGIPDDKDNCRLVANPDQADSDGDGRGDACKDDFDQDSVPDIDDICPENVEISET
DFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFFVN
TERDDDYAGFVFGYQSSSRFYVVMWKQITQSYWDSTPTKAQGYSGLSIKVVNSTTGPGEH
LRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADS
GPIYDKTYAGGRLGLFDFSQEMVFFSDLKYECRDP
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atggggccagccgctgttgtcgtcctcctcctcctggcgctcggcggcccggaagccaaa
cgcacggcagagtccaggggtgatgatgacagcgtctttgatatctttgaactcactgtt
cgcaagggagctgggcgccgggcacctggggtgcacctggtgaaggggccggacacctcc
agccctgcttaccgcatcgaagatgccagtcgcatccctgccgtctctgactccaagttc
caagacttgttagatatcatccatgctgagaagggcttcatccttcaggccactctgcgg
caagccaagaagagcagaggcacactgctggctgtggaacggaaagatggctctggtcac
gttttcagcctagtttcaaatggcaaggcaggcaccttggacctgagcctctctggtgat
ggcaagcagcagttagtgtctgtagaggatgccttgttagctacgggacactggaagaac
atcaccttgtttgtgcaagaagaccgtgctcagctttacgtggggtgtgagaaaatggag
aatgctgaactggacattcccatccaaaacatcttcacaagggacctggccagcagtgcc
aggctccgtattgctaaagggggagtcaatgacaacttccagggactgttgcagaatgtg
cggtttgtgtttagaacgactctggaaactatcatgaggaacaaaggctgctccagctct
actagtgcaatcattactttggacaaacccatgaatggttccagcccagctatccgcacc
aattacattggccataaaacaaaggatattcaagcagtctgtggcttttcctgtgatgaa
ctaactaacatgtttgtggaactgcaagggctacggtccatggttacaacacttcaagac
agagttcgcaaagtgactgaagaaaatgaactgattgccaaagtggtccagatcactccc
ggagtatgcattcataatgggatcttgcacaaaaataaggaagagtggactattgacagc
tgcactgaatgtacttgccagaactctgccactatatgccggaaagtgtcttgccctctc
atgccctgttccaatgccactgtgcctgatggggagtgctgcccccgatgctggcctagt
gactatgcagatgatggatggtctccttggtctgaatggacttcatgttcagtgacctgt
gggaatggaattcagcagagagggcgttcctgtgacagtctcaacaatcgctgtgaaggg
tcttctgtgcagactcggacttgccaccttcaggagtgtgataagagatttaaacaagat
ggtggttggagccactggtcaccgtggtcatcatgttcagtcacctgtggtacaggcatg
atcactagaattcgtctctgcaactctccagtaccacagctgaatggcaagccttgtgag
ggtgaagcaagagaaaccaagtcttgccagaaagatccttgcccaattaatggcaactgg
ggaccatggtctccgtgggatgcttgcacagtgacgtgtggaggaggacttcagaaacgc
agccgtctctgtaataatcctgagcctcaatatggtgggaaggcttgtgtaggtgaagct
aaaggaactcaggtctgcaacaaacaggactgtccagttgatgggtgtctgtctaatccc
tgctttgcgggaactacatgtacaagctcccctgatggttcttggaagtgcggtgcctgt
cctgctggctaccatggtaatggtatccactgccaagatattgatgagtgcaaagaggtt
cctgatgcctgctttgtcttcaatggagtgcacaggtgtgagaatactgaacctggatac
aactgtctgccttgtccaccacatttcactgggtcacagccatttggtcgcagtgttgag
gatgccacggcaaacaaacaggtctgcaagccacgtaatccatgcacggatggaacacat
gattgcaacaagaatgccaaatgcaattaccttggccacttcagtgacccaatgtatcgt
tgtgaatgtaaaccaggctatgctggcaatggcataatctgtggagaagatactgacttg
gatggatggccaaatgagaaccttgtctgtgttgccaatgccacttaccactgtaaaaaa
gataactgccccaatctccccaactctgggcaggaagactatgataaagatgggattggt
gatgcctgtgataatgacgatgatgatgatggtattcctgatgacagggacaactgccca
ttcatctacaacccacagcagtatgactatgacagggatgatgttggtgaccgttgtgat
aactgcccctacaatcacaaccctgatcagattgacactgacaacaacggagaaggagat
gcatgtgcagtggatattgatggagatggtgtcctcaacgaaagggacaactgccaatat
gtctacaatgtagaccagagggacacagatttggatggtgttggagatcagtgtgataac
tgtccactggaacataatccggaccaggaagatactgactctgaccttataggtgatgaa
tgtgataacaaccaggatatagatgaagatggtcatcaaaataatcttgataattgccct
tatgtgcccaatgccaatcaagctgatcatgacaaggatggaaaaggtgatgcctgtgac
catgatgatgacaatgatggtattcctgatgacaaagataactgcagattggttgccaac
ccagatcaagcggattctgatggtgatggacgtggagatgcttgcaaagatgactttgac
caagacagtgtgccagacattgatgacatctgccctgaaaatgtggaaatcagtgagact
gacttcagaaggtttcagatgattcccttggatccaaaaggaacatcccaaaatgatcca
aactgggttgtgcgtcaccagggtaaagaactggttcagacagtcaactgtgaccctggc
cttgcagttggttttgatgaattcaatgctgtggacttcagtggcaccttctttgtcaat
acagaaagggatgatgattatgctggctttgtgtttggctaccagtctagcagtcgtttc
tacgttgtcatgtggaaacagatcactcagtcttactgggactccacaccaaccaaagct
caaggctactcaggtctctccatcaaggttgtgaattccaccacaggtccaggagaacac
cttcgtaatgctctgtggcacacaggaaacactcctggccaggtgagaactttgtggcat
gaccctcgccacataggctggaaagacttcactgcatacagatggcgccttagccataga
ccaaagactggctacatcagagttgtaatgtatgaggggaagaaaatcatggcagactca
ggaccaatctatgataaaacttatgctggtggtcgtctaggattatttgacttctctcaa
gaaatggtgttcttctcagatcttaaatatgaatgcagagatccataa

DBGET integrated database retrieval system