KEGG   Gallus gallus (chicken): 373987Help
Entry
373987            CDS       T01006                                 

Gene name
THBS1, thrombospondin-1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  
thrombospondin 1
Organism
gga  Gallus gallus (chicken)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    373987 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    373987 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    373987 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    373987 (THBS1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    373987 (THBS1)
Membrane trafficking [BR:gga04131]
 Endocytosis
  Phagocytosis
   Opsonins
    373987 (THBS1)
Cell adhesion molecules and their ligands [BR:gga04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     373987 (THBS1)
Glycosaminoglycan binding proteins [BR:gga00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   373987 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
5
AA seq 1175 aa AA seqDB search
MGPAAVVVLLLLALGGPEAKRTAESRGDDDSVFDIFELTVRKGAGRRAPGVHLVKGPDTS
SPAYRIEDASRIPAVSDSKFQDLLDIIHAEKGFILQATLRQAKKSRGTLLAVERKDGSGH
VFSLVSNGKAGTLDLSLSGDGKQQLVSVEDALLATGHWKNITLFVQEDRAQLYVGCEKME
NAELDIPIQNIFTRDLASSARLRIAKGGVNDNFQGLLQNVRFVFRTTLETIMRNKGCSSS
TSAIITLDKPMNGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMVTTLQD
RVRKVTEENELIAKVVQITPGVCIHNGILHKNKEEWTIDSCTECTCQNSATICRKVSCPL
MPCSNATVPDGECCPRCWPSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEG
SSVQTRTCHLQECDKRFKQDGGWSHWSPWSSCSVTCGTGMITRIRLCNSPVPQLNGKPCE
GEARETKSCQKDPCPINGNWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYGGKACVGEA
KGTQVCNKQDCPVDGCLSNPCFAGTTCTSSPDGSWKCGACPAGYHGNGIHCQDIDECKEV
PDACFVFNGVHRCENTEPGYNCLPCPPHFTGSQPFGRSVEDATANKQVCKPRNPCTDGTH
DCNKNAKCNYLGHFSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKK
DNCPNLPNSGQEDYDKDGIGDACDNDDDDDGIPDDRDNCPFIYNPQQYDYDRDDVGDRCD
NCPYNHNPDQIDTDNNGEGDACAVDIDGDGVLNERDNCQYVYNVDQRDTDLDGVGDQCDN
CPLEHNPDQEDTDSDLIGDECDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACD
HDDDNDGIPDDKDNCRLVANPDQADSDGDGRGDACKDDFDQDSVPDIDDICPENVEISET
DFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFFVN
TERDDDYAGFVFGYQSSSRFYVVMWKQITQSYWDSTPTKAQGYSGLSIKVVNSTTGPGEH
LRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADS
GPIYDKTYAGGRLGLFDFSQEMVFFSDLKYECRDP
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atggggccagccgctgttgtcgtcctcctcctcctggcgctcggcggcccggaagccaaa
cgcacggcagagtccaggggtgatgatgacagcgtctttgatatctttgaactcactgtt
cgcaagggagctgggcgccgggcacctggggtgcacctggtgaaggggccggacacctcc
agccctgcttaccgcatcgaagatgccagtcgcatccctgccgtctctgactccaagttc
caagacttgttagatatcatccatgctgagaagggcttcatccttcaggccactctgcgg
caagccaagaagagcagaggcacactgctggctgtggaacggaaagatggctctggtcac
gttttcagcctagtttcaaatggcaaggcaggcaccttggacctgagcctctctggtgat
ggcaagcagcagttagtgtctgtagaggatgccttgttagctacgggacactggaagaac
atcaccttgtttgtgcaagaagaccgtgctcagctttacgtggggtgtgagaaaatggag
aatgctgaactggacattcccatccaaaacatcttcacaagggacctggccagcagtgcc
aggctccgtattgctaaagggggagtcaatgacaacttccagggactgttgcagaatgtg
cggtttgtgtttagaacgactctggaaactatcatgaggaacaaaggctgctccagctct
actagtgcaatcattactttggacaaacccatgaatggttccagcccagctatccgcacc
aattacattggccataaaacaaaggatattcaagcagtctgtggcttttcctgtgatgaa
ctaactaacatgtttgtggaactgcaagggctacggtccatggttacaacacttcaagac
agagttcgcaaagtgactgaagaaaatgaactgattgccaaagtggtccagatcactccc
ggagtatgcattcataatgggatcttgcacaaaaataaggaagagtggactattgacagc
tgcactgaatgtacttgccagaactctgccactatatgccggaaagtgtcttgccctctc
atgccctgttccaatgccactgtgcctgatggggagtgctgcccccgatgctggcctagt
gactatgcagatgatggatggtctccttggtctgaatggacttcatgttcagtgacctgt
gggaatggaattcagcagagagggcgttcctgtgacagtctcaacaatcgctgtgaaggg
tcttctgtgcagactcggacttgccaccttcaggagtgtgataagagatttaaacaagat
ggtggttggagccactggtcaccgtggtcatcatgttcagtcacctgtggtacaggcatg
atcactagaattcgtctctgcaactctccagtaccacagctgaatggcaagccttgtgag
ggtgaagcaagagaaaccaagtcttgccagaaagatccttgcccaattaatggcaactgg
ggaccatggtctccgtgggatgcttgcacagtgacgtgtggaggaggacttcagaaacgc
agccgtctctgtaataatcctgagcctcaatatggtgggaaggcttgtgtaggtgaagct
aaaggaactcaggtctgcaacaaacaggactgtccagttgatgggtgtctgtctaatccc
tgctttgcgggaactacatgtacaagctcccctgatggttcttggaagtgcggtgcctgt
cctgctggctaccatggtaatggtatccactgccaagatattgatgagtgcaaagaggtt
cctgatgcctgctttgtcttcaatggagtgcacaggtgtgagaatactgaacctggatac
aactgtctgccttgtccaccacatttcactgggtcacagccatttggtcgcagtgttgag
gatgccacggcaaacaaacaggtctgcaagccacgtaatccatgcacggatggaacacat
gattgcaacaagaatgccaaatgcaattaccttggccacttcagtgacccaatgtatcgt
tgtgaatgtaaaccaggctatgctggcaatggcataatctgtggagaagatactgacttg
gatggatggccaaatgagaaccttgtctgtgttgccaatgccacttaccactgtaaaaaa
gataactgccccaatctccccaactctgggcaggaagactatgataaagatgggattggt
gatgcctgtgataatgacgatgatgatgatggtattcctgatgacagggacaactgccca
ttcatctacaacccacagcagtatgactatgacagggatgatgttggtgaccgttgtgat
aactgcccctacaatcacaaccctgatcagattgacactgacaacaacggagaaggagat
gcatgtgcagtggatattgatggagatggtgtcctcaacgaaagggacaactgccaatat
gtctacaatgtagaccagagggacacagatttggatggtgttggagatcagtgtgataac
tgtccactggaacataatccggaccaggaagatactgactctgaccttataggtgatgaa
tgtgataacaaccaggatatagatgaagatggtcatcaaaataatcttgataattgccct
tatgtgcccaatgccaatcaagctgatcatgacaaggatggaaaaggtgatgcctgtgac
catgatgatgacaatgatggtattcctgatgacaaagataactgcagattggttgccaac
ccagatcaagcggattctgatggtgatggacgtggagatgcttgcaaagatgactttgac
caagacagtgtgccagacattgatgacatctgccctgaaaatgtggaaatcagtgagact
gacttcagaaggtttcagatgattcccttggatccaaaaggaacatcccaaaatgatcca
aactgggttgtgcgtcaccagggtaaagaactggttcagacagtcaactgtgaccctggc
cttgcagttggttttgatgaattcaatgctgtggacttcagtggcaccttctttgtcaat
acagaaagggatgatgattatgctggctttgtgtttggctaccagtctagcagtcgtttc
tacgttgtcatgtggaaacagatcactcagtcttactgggactccacaccaaccaaagct
caaggctactcaggtctctccatcaaggttgtgaattccaccacaggtccaggagaacac
cttcgtaatgctctgtggcacacaggaaacactcctggccaggtgagaactttgtggcat
gaccctcgccacataggctggaaagacttcactgcatacagatggcgccttagccataga
ccaaagactggctacatcagagttgtaatgtatgaggggaagaaaatcatggcagactca
ggaccaatctatgataaaacttatgctggtggtcgtctaggattatttgacttctctcaa
gaaatggtgttcttctcagatcttaaatatgaatgcagagatccataa

DBGET integrated database retrieval system