KEGG   Gallus gallus (chicken): 373991Help
Entry
373991            CDS       T01006                                 

Gene name
CLOCK
Definition
clock homolog (mouse) (EC:2.3.1.48)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    373991 (CLOCK)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     373991 (CLOCK)
Transcription factors [BR:gga03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    373991 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 852 aa AA seqDB search
MFFTISTHKMSSIADRNDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFPSNEEFTQLMLEALDG
FFLAIMTDGNIIYVSESVTPLLEHLPSDLVDQSVFNFIPEGEHSEIYKILSSHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEQPTYEYVKFIDNFKCLNNVPNSAHNGFEGTIQRS
HRPSYEDKVCFIATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLDNLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPEIKADKSQDSGSDNHINTVSLKEA
LERFDTSPTPSASSRSSRKSSHTAVSDHSSTPTKMTVDTSTPPRQSLSAHEKSTQRRSSL
SSQSLSSQSLGQPVTQPTMSQPATLQHQSSMSQFSAQLGAMQHLKDQLEQRTRMIEANIH
RQQEELRKIQEQLQIVHGQGLQMFLQQSTSGLNFSSVQLTSGNSSSVQQLAPGNMQGQVV
QTNQTQSGMNTGHTSTPHMIQQQPLQSSASQHNQQNVLSGHGQQSSLAGQSQNTVSTPLY
NTMVISQPTAGNVVQVPSSLPQNNNQNAAAVTTFTQDRQIRFSQGQQLVTKLVTAPVACG
AVMVPSTMFMGQVVTAYPTFAAQQQQPQTLPVTQQQQQQQQQSQQDQQQQQQQLTAVQQP
AQPQLTQHPQQFLQTSRLLHGNQSAQLILSAAFPLQQSTFTQSHHQQHQPQQQQLSRHRT
DKMTDPSKAQPQ
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaccataagcacccataaaatgagctccattgcagacagaaatgatggaagc
atttttgatggtctggtggaagaagatgacaaagataaagcaaagagagtgtctagaaac
aagtctgaaaagaaacgtcgagatcagtttaatgttcttatcaaagagctgggttccatg
cttccaggtaatgctcggaagatggataaatccactgtactgcagaagagcattgacttt
ttacggaagcacaaagaaattactgcacagtcagatgccagtgagattcgacaggactgg
aaaccaacattccctagtaatgaagagttcacgcagttaatgttagaggctcttgatggt
ttttttttagcaattatgacagatggaaatataatatatgtgtctgaaagtgtaactcct
ttacttgaacatttgccatctgatcttgtggatcagagtgtatttaattttatcccagag
ggggaacattcagaaatttataaaattctgtcttctcatctgctggaaagcgattcattg
acaccggaatacttaaaatcaaaaaatcagctagaattctgttgccatatgctgcgagga
acaatagacccaaaagagcaacctacgtatgaatatgtaaaatttatagacaatttcaag
tgtttgaataatgttcccaattcggcacacaacggttttgaaggaactattcagcggtcg
caccggccttcatatgaagacaaagtttgctttatagccacagttagattagctacacct
caatttatcaaggaaatgtgcactgttgaagaacccaatgaagagttcacatctaggcat
agcttagaatggaagttcctattcttggatcacagggcacctccaataataggctatctt
ccatttgaagttttgggaacatcaggctatgattattatcatgtggatgatctagataat
ctggcaaaatgtcatgagcatttaatgcaatatgggaaagggaagtcatgttattacaga
ttccttacaaagggacagcaatggatttggctgcaaacacattactatatcacgtaccac
cagtggaattccaggccagagtttattgtctgtacgcacacagttgtaagttatgcagaa
gtcagagcagaaaggcggcgagaacttggtatcgaggagtctctgccagagataaaagca
gataaaagtcaagactctgggtctgataatcacataaacacggtgagcctcaaagaagct
ctggaaaggtttgataccagccccacaccttctgcttcctccaggagttcaagaaaatct
tcacatactgcagtatcagatcattcatcgacaccaactaaaatgacagtggacactagc
actcccccaagacaaagcttatctgctcatgaaaagtctacacaaagaagatcatctctg
agtagtcagtctttaagctcccagtctcttggacaaccagtaacacagccaacgatgtcg
cagcctgctactttacagcaccagtccagcatgtcccagttttcagctcaattaggagct
atgcagcacctaaaggaccagctagagcaaagaacacgcatgatagaggcaaatattcat
cggcagcaggaagagttgcggaaaattcaagaacagcttcagattgtccacggtcaagga
ctgcagatgttcttgcagcagtcaacttctggactaaacttcagttctgtgcagcttaca
tctggaaattcttcaagtgttcagcaacttgcaccaggaaacatgcaaggtcaggttgtt
cagactaatcagactcaaagtggaatgaacacaggacatacaagtacaccacacatgatc
cagcaacagcctttgcagagctctgcatcacagcataatcagcaaaatgtacttagtgga
cacggtcaacaatcttctcttgccggtcagtcccagaacacagtctcaacacctttgtat
aacactatggtgatttctcagccaacagccggaaatgtggtccaggttccttctagctta
ccacagaacaataaccagaatgctgctgcagtaactacttttacacaagatagacaaatc
agattttctcaaggtcagcagcttgtaacaaaacttgtcacagccccagtagcgtgtgga
gcggtaatggtaccaagtactatgtttatgggacaggtggtgacagcttatcccactttt
gctgcccaacagcagcagccacagactttgccagtaacacagcagcaacagcagcagcag
cagcaaagtcagcaagaccagcagcagcagcagcagcagctcactgcagttcaacaacca
gctcagccacagctgacccagcacccgcaacagttcctacagacatccaggttacttcac
gggaatcagtcagctcagcttatcctctctgctgctttcccactacagcaaagcactttt
actcagtcccaccaccagcagcaccagccacagcagcagcagctctcacggcacagaact
gacaagatgacggatccttccaaagctcagccacagtag

DBGET integrated database retrieval system