KEGG   Gallus gallus (chicken): 374012Help
Entry
374012            CDS       T01006                                 

Gene name
BIRC2, IAP1, ITA
Definition
(RefSeq) baculoviral IAP repeat containing 2
  KO
K16060  
baculoviral IAP repeat-containing protein 2/3
Organism
gga  Gallus gallus (chicken)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    374012 (BIRC2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    374012 (BIRC2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    374012 (BIRC2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    374012 (BIRC2)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    374012 (BIRC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 610 aa AA seqDB search
MNIMDSSPLLASVMKQNAHCGELKYDLSCELYRMSTFSTFPVNVPVSERRLARAGFYYTG
VQDKVKCFSCGLVLDNWQPGDNAMEKHKQVYPSCSFVQNMLSLNNLGLSTHSAFSPLVAS
NLSPSLRSMTLSPSFEQVGYFSGSFSSFPQDPVTTRAAEDLSHLRSKLHNPSMSTEEARL
RTFHAWPLMFLSPAELAKAGLYYLGTADKVACFTCGGQLSNWEPKDNAMSEHRRHFPNCP
FVENLMRDQPSFNVSNVTMQTHEARVKTFINWPTRIPVQPEQLADAGFYYVGRNDDVKCF
CCDGGLRCWESGDDPWIEHAKWFPRCEYLLRVKGGEFVSQVQARFPHLLEQLLSTSDTPV
DENMDPIIHFEPGESPSEDAIMMNTPVVKAALEMGFSRRLIKQTVQSKILATEENYKTVN
DLVSDLLTAEDEKREEEKERQFEEVASDDLSLIRKNRMALFQRLTSVLPILGSLLSAKVI
TELEHDVIKQKTQTPLQARELIDTVLVKGNAAASIFRNCLKDCDPVLYKDLFVEKSMKYV
PTEDVSGLPMEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKECAPSLRKCPICRGT
IKGTVRTFLS
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaacataatggatagtagccctttgttggcgagcgtgatgaagcagaatgctcactgt
ggggaactgaagtatgacttatcttgtgagctctacagaatgtcaacgttttctactttc
cctgttaacgtgccggtgtcagaacgaaggcttgcccgggctgggttttattacaccggt
gtccaagataaagttaagtgcttcagttgtggcttagtgttggacaactggcagccagga
gataatgctatggagaagcacaaacaggtgtatcctagctgcagttttgttcaaaacatg
ctatcacttaacaaccttggactgtccactcattctgccttttctcctttggtcgcaagc
aatctttcaccatctctacgttccatgacactttctccaagctttgaacaagttggctat
ttcagtggctctttttccagttttcctcaagacccagtaactactagggctgccgaagac
ctctcacacttaagatctaagcttcacaacccttccatgagtacagaagaagctaggctg
cgcactttccatgcatggcccctgatgtttctctcgcccgccgagctggcaaaagctgga
ctttattacctggggacagcagacaaagttgcatgtttcacctgcggtggtcagttgagt
aactgggagccaaaagataatgccatgtcagagcatcggaggcactttcctaactgccct
tttgtggaaaacctcatgcgagaccaaccaagtttcaatgtttccaatgtgaccatgcaa
acccatgaagcccgtgttaaaacattcattaactggccaactcggattccagttcagcct
gaacagcttgcagatgctggtttttactatgtaggccgcaacgatgatgtcaagtgtttt
tgctgtgatggtgggctaaggtgctgggaatctggagatgatccatggattgagcatgca
aagtggtttccgaggtgtgagtatctgcttcgtgtgaaaggaggagagtttgtaagtcaa
gttcaggccaggtttcctcatcttcttgaacagctcctgtcaacttctgatacacccgta
gatgaaaacatggatccaattattcatttcgagcctggagagagtccttcagaagatgca
atcatgatgaacactcctgtagttaaagctgccttggagatgggattcagtaggcgtcta
ataaagcaaacagtgcaaagtaaaattctagccactgaagaaaactacaagactgttaat
gatcttgtgtctgatctgctcaccgctgaagatgagaagagggaggaagagaaagagaga
cagtttgaggaagtggcatcagatgatttgtccttaatccggaagaatcggatggcttta
ttccagcgtttaacctcagtacttccaatccttgggagtttactttcagctaaagtgata
acagaacttgagcatgatgtcattaagcaaaagactcagacaccattgcaagcaagggaa
ctgattgatacagttctagtgaaaggcaatgcagcagccagcatattcagaaactgtcta
aaggattgtgaccctgtactttacaaagacttatttgtggagaagagcatgaagtatgtt
cccacagaagatgtgtcaggcttacctatggaagaacaactaaggagattgcaagaagag
agaacatgtaaagtttgcatggacaaagaagtttctattgtttttattccgtgtgggcac
ttagtggtatgcaaagaatgtgcaccatcccttagaaaatgccctatttgcaggggaaca
ataaagggtacagttcgtacgtttctttcataa

DBGET integrated database retrieval system