KEGG   Gallus gallus (chicken): 374012Help
Entry
374012            CDS       T01006                                 

Gene name
BIRC2, IAP1, ITA
Definition
(RefSeq) baculoviral IAP repeat containing 2
  KO
K16060  
baculoviral IAP repeat-containing protein 2/3
Organism
gga  Gallus gallus (chicken)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    374012 (BIRC2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    374012 (BIRC2)
  Cellular commiunity
   04510 Focal adhesion
    374012 (BIRC2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    374012 (BIRC2)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    374012 (BIRC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 610 aa AA seqDB search
MNIMDSSPLLASVMKQNAHCGELKYDLSCELYRMSTFSTFPVNVPVSERRLARAGFYYTG
VQDKVKCFSCGLVLDNWQPGDNAMEKHKQVYPSCSFVQNMLSLNNLGLSTHSAFSPLVAS
NLSPSLRSMTLSPSFEQVGYFSGSFSSFPQDPVTTRAAEDLSHLRSKLHNPSMSTEEARL
RTFHAWPLMFLSPAELAKAGLYYLGTADKVACFTCGGQLSNWEPKDNAMSEHRRHFPNCP
FVENLMRDQPSFNVSNVTMQTHEARVKTFINWPTRIPVQPEQLADAGFYYVGRNDDVKCF
CCDGGLRCWESGDDPWIEHAKWFPRCEYLLRVKGGEFVSQVQARFPHLLEQLLSTSDTPV
DENMDPIIHFEPGESPSEDAIMMNTPVVKAALEMGFSRRLIKQTVQSKILATEENYKTVN
DLVSDLLTAEDEKREEEKERQFEEVASDDLSLIRKNRMALFQRLTSVLPILGSLLSAKVI
TELEHDVIKQKTQTPLQARELIDTVLVKGNAAASIFRNCLKDCDPVLYKDLFVEKSMKYV
PTEDVSGLPMEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKECAPSLRKCPICRGT
IKGTVRTFLS
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaacataatggatagtagccctttgttggcgagcgtgatgaagcagaatgctcactgt
ggggaactgaagtatgacttatcttgtgagctctacagaatgtcaacgttttctactttc
cctgttaacgtgccggtgtcagaacgaaggcttgcccgggctgggttttattacaccggt
gtccaagataaagttaagtgcttcagttgtggcttagtgttggacaactggcagccagga
gataatgctatggagaagcacaaacaggtgtatcctagctgcagttttgttcaaaacatg
ctatcacttaacaaccttggactgtccactcattctgccttttctcctttggtcgcaagc
aatctttcaccatctctacgttccatgacactttctccaagctttgaacaagttggctat
ttcagtggctctttttccagttttcctcaagacccagtaactactagggctgccgaagac
ctctcacacttaagatctaagcttcacaacccttccatgagtacagaagaagctaggctg
cgcactttccatgcatggcccctgatgtttctctcgcccgccgagctggcaaaagctgga
ctttattacctggggacagcagacaaagttgcatgtttcacctgcggtggtcagttgagt
aactgggagccaaaagataatgccatgtcagagcatcggaggcactttcctaactgccct
tttgtggaaaacctcatgcgagaccaaccaagtttcaatgtttccaatgtgaccatgcaa
acccatgaagcccgtgttaaaacattcattaactggccaactcggattccagttcagcct
gaacagcttgcagatgctggtttttactatgtaggccgcaacgatgatgtcaagtgtttt
tgctgtgatggtgggctaaggtgctgggaatctggagatgatccatggattgagcatgca
aagtggtttccgaggtgtgagtatctgcttcgtgtgaaaggaggagagtttgtaagtcaa
gttcaggccaggtttcctcatcttcttgaacagctcctgtcaacttctgatacacccgta
gatgaaaacatggatccaattattcatttcgagcctggagagagtccttcagaagatgca
atcatgatgaacactcctgtagttaaagctgccttggagatgggattcagtaggcgtcta
ataaagcaaacagtgcaaagtaaaattctagccactgaagaaaactacaagactgttaat
gatcttgtgtctgatctgctcaccgctgaagatgagaagagggaggaagagaaagagaga
cagtttgaggaagtggcatcagatgatttgtccttaatccggaagaatcggatggcttta
ttccagcgtttaacctcagtacttccaatccttgggagtttactttcagctaaagtgata
acagaacttgagcatgatgtcattaagcaaaagactcagacaccattgcaagcaagggaa
ctgattgatacagttctagtgaaaggcaatgcagcagccagcatattcagaaactgtcta
aaggattgtgaccctgtactttacaaagacttatttgtggagaagagcatgaagtatgtt
cccacagaagatgtgtcaggcttacctatggaagaacaactaaggagattgcaagaagag
agaacatgtaaagtttgcatggacaaagaagtttctattgtttttattccgtgtgggcac
ttagtggtatgcaaagaatgtgcaccatcccttagaaaatgccctatttgcaggggaaca
ataaagggtacagttcgtacgtttctttcataa

DBGET integrated database retrieval system