KEGG   Gallus gallus (chicken): 374037Help
Entry
374037            CDS       T01006                                 

Gene name
HAT1
Definition
histone acetyltransferase 1 (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
7
AA seq 408 aa AA seqDB search
MAGLTPMEKKLAEYKCNTNEAIQLKLVRFPEDLEDDNTTFNPEYSHQVFGDDEVAFGYKG
LKILLYYIAGNLSTLFRIEYTSKVNEKFDCVEADDVESKIREIIPPGFCSNTDDFVSLLE
KEVNFKPFGMLLHTYSVHNEEAGEDITYQIYKADMTCPGFREYHERLQTFLMWFIETASF
IDVDDERWNYFIVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEG
HGAQLLETVHRYYMSSPTVLDITAEDPSENYIKLRDFVLVKLCQDLPCFSPAKLMQGFSQ
EMVMEAQQKLKINKQHTRRVYEILRLRATDMGDAEQSRSYRLDVKRRLIGPYKKKQRELA
KMRRCLRPEELTNQLNQIDLNMQHEQLEESFQQLVSDYRRVLERLAQA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacttactcctatggagaagaagctggctgaatacaaatgtaacacaaacgaa
gcaatccagctaaaactagttcgctttcctgaggatttggaggatgacaacacaacattt
aacccagagtatagccatcaagtgtttggtgatgatgaagttgcctttggctacaaggga
ctgaagattctcttatactacatcgctggtaacctgtcaactctcttccgcattgaatat
acatctaaagttaatgagaagtttgactgtgtggaggcagatgatgttgaaagtaaaatt
agagaaattattcctcctggcttctgttcaaacacagatgactttgtctctctgttggaa
aaggaagtcaactttaagccctttggaatgctgctgcacacatattctgttcataacgag
gaagctggtgaagacattacatatcagatatataaggctgacatgacgtgtccaggcttt
cgagaatatcatgaaaggcttcagacattcttgatgtggtttattgaaactgctagcttt
attgatgtagatgatgaaagatggaactactttatagtatttgagaagtataataaggat
ggagctacgctctttgcgaccgtaggctacatgacagtctataattactatgtgtaccca
gacaaaacccggccacgtgtaagccagatgctgatcttgccaccattccaaggagaaggc
catggtgctcagcttcttgaaacagttcatagatactatatgtcttctcctacagtactt
gatataacagctgaagatccatctgaaaactacataaagctaagagactttgttcttgta
aagctctgtcaagacttgccttgcttttccccagcaaagttaatgcaaggcttcagccaa
gaaatggtaatggaagctcaacagaagctgaaaataaataagcaacacacaaggcgagta
tatgaaattctccgattgcgtgcaacagatatgggcgatgcagaacaatccagaagctac
cggttggatgttaaaagaaggctgattggcccctataagaagaagcagagagaacttgcc
aagatgagaaggtgcttaagaccagaggagttgacaaatcagttgaaccaaatagaccta
aacatgcaacatgaacagttagaagagagcttccaacaactcgtttcagattaccgaaga
gtcctagaacgacttgcgcaagcatga

DBGET integrated database retrieval system