KEGG   Gallus gallus (chicken): 374064Help
Entry
374064            CDS       T01006                                 

Gene name
PFKM
Definition
phosphofructokinase, muscle (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    374064 (PFKM)
   01230 Biosynthesis of amino acids
    374064 (PFKM)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    374064 (PFKM)
   00030 Pentose phosphate pathway
    374064 (PFKM)
   00051 Fructose and mannose metabolism
    374064 (PFKM)
   00052 Galactose metabolism
    374064 (PFKM)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     374064 (PFKM)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     374064 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
Un
AA seq 782 aa AA seqDB search
MAQPPKHCGSGEHMGAGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVYFVHEGYQGL
VDGGDNLKEATWESVSMMLQLGGTVIGSARCQDFRTREGRLKAARNLVKRGITNLCVIGG
DGSLTGADTFRAEWSSLLAELLKTGGITAEEAKKSSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALITSLACGADWVFIPESPPEDG
WEDHLCRPTETRLGGSRLNIIIVAEGAIDRHGKAITSDDVKDLVVKRLGYDTRVTILGHV
QRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVT
TAMNERRFDDAVKLRGRSFQNNWNVYKLLAHIRPPSTKSGHTLAVLNVGAPAAGMNAAVR
STVRIGLIHGHRMLAVHDGFEGLALGKVEDISWDMVGGWTGLGGSKLGTKRTLPKKYFEE
ISATISTFGIHGLIIIGGFEAFMGSLELMDGRAKFEELCIPICVIPATVSNNVPGSDFSI
GADTALNTITTTCDRIKQSAAGTKRRVFIIETMGTWPPWQGGYCGYLAAGADAAYIFEEH
FSIRDLQINVEHLTEKMKTTVKRGLVLRNEHCNENYTTDFIYNLYTEEGKGIFDCRKNVL
GHMQQGGAPTPFDRNFGTKMGAKSVAWITGKIKECSRHGRIFANTADSACLLGMRKRSLV
FQPLTELKEQTDFQHRIPKEQWWLKLRPILKILAKYNIELDTSEKALMEHVRQKRISQES
NI
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcccccaaagcattgcgggagcggggagcacatgggtgctggaaaagccatc
gctgtcctcacctcagggggggacgcacagggcatgaatgcggctgtccgcgccgtggtg
cgggtgggcatttacaccggtgccaaagtctacttcgtgcatgagggctaccaggggctg
gtggacggcggggacaacctcaaagaggccacgtgggagagcgtctccatgatgctgcag
ttgggtgggacggtcatcggcagcgcccgctgccaggatttccgcacacgcgaaggacgc
ctgaaagccgcccgcaatctggtgaagcgcggcatcaccaacctctgcgtcatcggcggc
gacggcagcctcaccggtgccgacaccttccgtgccgaatggagcagcctcctggccgag
ctgctgaaaacaggggggatcacggcggaggaggcgaagaagtcgagccacctgaacatc
gtgggcatggtgggctccatcgacaacgacttctgtggcacagacatgaccatcggcacc
gactcagcgctgcaccgcatcatggagatcgtggatgccatcaccaccacagcccagagc
caccagaggacgtttgtgctggaagtgatgggtcgtcactgcggctacctggctctcatc
acctccctggcctgcggtgctgactgggtcttcatccctgagtccccccctgaggatggc
tgggaggaccacttgtgccgaccgacggagacccgtttgggtggctcaaggctgaacatc
atcatcgtggctgagggtgccatcgacagacacggcaaggccatcacctctgacgacgtc
aaagatctggtggtgaagcgtttgggctacgacacccgcgtcaccatcctgggccacgtg
cagcgcggtgggacaccctccgcctttgaccgcatcctgggcagcaggatgggagttgaa
gccgtcatggccttgctggaagggacccccgatacccctgcctgtgtcgtcagcctctca
gggaaccaggccgtgcgcctgcccctcatggagtgcgtgcaggtgaccaaagatgtgaca
acagcgatgaatgagagacgcttcgatgacgctgtgaaactgcggggccggagtttccaa
aataactggaacgtctacaagctgctggcacacatccgcccaccctccaccaagagcggt
cacacattggctgtgctcaatgtgggtgccccagctgctggcatgaacgcggccgtgcgt
tccaccgtgaggatcggactcatccatgggcacaggatgctggcggtgcacgacggcttc
gaggggctcgccttggggaaagtcgaagatatcagctgggatatggttggcggctggaca
ggtctggggggatccaaactggggacgaagaggaccttgcccaagaaatacttcgaggaa
atcagcgccaccatcagcaccttcggcatccacgggctgatcatcatcgggggctttgag
gccttcatgggcagcctggagctgatggacgggagagccaagtttgaggagctctgcatc
cccatctgcgtcatccccgccaccgtctccaacaacgtccccggctccgacttcagcatc
ggcgccgacaccgctctcaacaccatcaccacgacctgcgaccgcatcaagcagtcggcg
gcggggaccaagcggcgcgtcttcatcatcgagacgatgggtacctggccaccatggcag
ggcggctactgcgggtacctggcagccggtgctgatgctgcctacatcttcgaggagcac
ttcagcatccgtgacctgcagatcaacgtggagcacttaactgaaaagatgaagacgacg
gtgaagcgcgggctggtgctcaggaatgagcactgcaacgagaactacaccactgacttc
atctacaacctctacacggaggagggcaaaggcatcttcgactgccgcaagaacgtactg
ggacacatgcagcagggtggcgccccgaccccctttgacaggaatttcggcactaaaatg
ggcgccaagtcggtggcttggatcactggcaagatcaaggagtgctcccggcacggtcgc
atctttgccaacacggctgactcggcgtgcctgctgggcatgcgcaagcgcagcctggtc
ttccagcccctcaccgagctcaaggagcagacagacttccagcaccgcatccccaaggaa
cagtggtggctgaagctgcgccccatcctgaagatcctggccaagtacaacatcgagctg
gacacctcggagaaggcactcatggagcacgtcaggcaaaagaggatctcacaggaatcc
aacatatga

DBGET integrated database retrieval system