KEGG   Gallus gallus (chicken): 374064Help
Entry
374064            CDS       T01006                                 

Gene name
PFKM
Definition
phosphofructokinase, muscle (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    374064 (PFKM)
   01230 Biosynthesis of amino acids
    374064 (PFKM)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    374064 (PFKM)
   00030 Pentose phosphate pathway
    374064 (PFKM)
   00051 Fructose and mannose metabolism
    374064 (PFKM)
   00052 Galactose metabolism
    374064 (PFKM)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    374064 (PFKM)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     374064 (PFKM)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     374064 (PFKM)
Messenger RNA biogenesis [BR:gga03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     374064 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
Un
AA seq 782 aa AA seqDB search
MAQPPKHCGSGEHMGAGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVYFVHEGYQGL
VDGGDNLKEATWESVSMMLQLGGTVIGSARCQDFRTREGRLKAARNLVKRGITNLCVIGG
DGSLTGADTFRAEWSSLLAELLKTGGITAEEAKKSSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALITSLACGADWVFIPESPPEDG
WEDHLCRRLTETRLGGSRLNIIIVAEGAIDRHGKAITSDDVKDLVVKRLGYDTRVTILGH
VQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDV
TTAMNERRFDDAVKLRGRSFQNNWNVYKLLAHIRPPSTKSGHTLAVLNVGAPAAGMNAAV
RSTVRIGLIHGHRMLAVHDGFEGLALGKVEDISWDMVGGWTGLGGSKLGTKRTLPKKYFE
EISATISTFGIHGLIIIGGFEAFMGSLELMDGRAKFEELCIPICVIPATVSNNVPGSDFS
IGADTALNTITTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEH
FSIRDLQINVEHLTEKMKTTVKRGLVLRNEHCNENYTTDFIYNLYTEEGKGIFDCRKNVL
GHMQQGGAPTPFDRNFGTKMGAKSVAWITGKIKECSRHGRIFANTADSACLLGMRKRSLV
FQPLTELKEQTDFQHRIPKEQWWLKLRPILKILAKYNIELDTSEKALMEHVRQKRISQES
NI
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcccccgaagcattgcgggagcggggagcacatgggtgctggaaaagccatc
gctgtcctcacctcagggggggacgcacagggcatgaatgcggctgtccgcgccgtggtg
cgggtgggcatttacaccggtgccaaagtctacttcgtgcatgagggctaccaggggctg
gtggacggcggggacaacctcaaagaggccacgtgggagagcgtctccatgatgctgcag
ttgggtgggacggtcatcggcagcgcccgctgccaggatttccgcacacgcgaaggacgc
ctgaaagccgcccgcaatctggtgaagcgcggcatcaccaacctctgcgtcatcggcggc
gacggcagcctcaccggtgccgacaccttccgtgccgaatggagcagcctcctggccgag
ctgctgaaaacaggggggatcacggcggaggaggcgaagaagtcgagccacctgaacatc
gtgggcatggtgggctccatcgacaacgacttctgtggcacagacatgaccatcggcacc
gactcagcgctgcaccgcatcatggagatcgtggatgccatcaccaccacagcccagagc
caccagaggacgtttgtgctggaagtgatgggtcgtcactgcggctacctggctctcatc
acctccctggcctgcggtgctgactgggtcttcatccctgagtccccccctgaggatggc
tgggaggaccacttgtgccgaaggctcacggagacccgtttgggtggctcaaggctgaac
atcatcatcgtggctgagggtgccatcgacagacacggcaaggccatcacctctgacgac
gtcaaagatctggtggtgaagcgtttgggctacgacacccgcgtcaccatcctgggccac
gtgcagcgcggtgggacaccctccgcctttgaccgcatcctgggcagcaggatgggagtt
gaagccgtcatggccttgctggaagggacccccgatacccctgcctgtgtcgtcagcctc
tcagggaaccaggccgtgcgcctgcccctcatggagtgcgtgcaggtgaccaaagatgtg
acaacagcgatgaatgagagacgcttcgatgacgctgtgaaactgcggggccggagtttc
caaaataactggaacgtctacaagctgctggcacacatccgcccaccctccaccaagagc
ggtcacacattggctgtgctcaatgtgggtgccccagctgctggcatgaacgcggccgtg
cgttccaccgtgaggatcggactcatccatgggcacaggatgctggcggtgcacgacggc
ttcgaggggctcgccttggggaaagtcgaagatatcagctgggatatggttggcggctgg
acaggtctggggggatccaaactggggacgaagaggaccttgcccaagaaatacttcgag
gaaatcagcgccaccatcagcaccttcggcatccacgggctgatcatcatcgggggcttt
gaggccttcatgggcagcctggagctgatggacgggagagccaagtttgaggagctctgc
atccccatctgcgtcatccccgccaccgtctccaacaacgtccccggctccgacttcagc
atcggcgccgacaccgctctcaacaccatcaccacgacctgcgaccgcatcaagcagtcg
gcggcggggaccaagcggcgcgtcttcatcatcgagacgatgggcggctactgcgggtac
ctggccaccatggcagggctggcagccggtgctgatgctgcctacatcttcgaggagcac
ttcagcatccgtgacctgcagatcaacgtggagcacttaactgaaaagatgaagacgacg
gtgaagcgcgggctggtgctcaggaatgagcactgcaacgagaactacaccactgacttc
atctacaacctctacacggaggagggcaaaggcatcttcgactgccgcaagaacgtactg
ggacacatgcagcagggtggcgccccgaccccctttgacaggaatttcggcactaaaatg
ggcgccaagtcggtggcttggatcactggcaagatcaaggagtgctcccggcacggtcgc
atctttgccaacacggctgactcggcgtgcctgctgggcatgcgcaagcgcagcctggtc
ttccagcccctcaccgagctcaaggagcagacagacttccagcaccgcatccccaaggaa
cagtggtggctgaagctgcgccccatcctgaagatcctggccaagtacaacatcgagctg
gacacctcggagaaggcactcatggagcacgtcaggcaaaagaggatctcacaggaatcc
aacatatga

DBGET integrated database retrieval system