KEGG   Gallus gallus (chicken): 374091Help
Entry
374091            CDS       T01006                                 

Gene name
P4HB, PDI
Definition
prolyl 4-hydroxylase, beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:gga04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
18
AA seq 515 aa AA seqDB search
MAVVRVRAIVALLCLVAALGLAQPLEEEDGVLVLRAANFEQALAAHRHLLVEFYAPWCGH
CKALAPEYAKAAAQLKAEGSEIRLAKVDATEEAELAQQFGVRGYPTIKFFRNGDKAAPRE
YTAGREADDIVSWLKKRTGPAATTLTDAAAAETLVDSSEVVVIGFFKDVTSDAAKEFLLA
AESVDDIPFGISSSADVFSKYQLSQDGVVLFKKFDEGRNNFEGDLTKDNLLNFIKSNQLP
LVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLDNFKTAAGNFKGKILFIFIDSDH
SDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDDLTADKIKEFCNKFLEGKIKPHL
MSQDLPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQLAPIWDKLGETYR
DHENIVIAKMDSTANEVEAVKIHSFPTLKFFPAGSGRNVIDYNGERTLEGFKKFLESGGQ
DGAAADDDLEDLETDEETDLEEGDDDEQKIQKDEL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggtgcgcgtgcgcgcgatcgtagcgctgctctgcctcgtggccgccctcggc
ctggcgcagccgctggaggaggaggacggcgtcctggtgctgcgcgccgccaacttcgag
caggccctggcggcgcaccgccacctgctcgtggagttctacgcgccgtggtgcgggcac
tgcaaggcgttggccccggagtacgcgaaggcggcggcgcagctgaaggcggagggttcc
gagatccgcctggccaaggtggacgccacggaggaggcggagctggcgcagcagttcggc
gtgcgcgggtaccccaccatcaagttcttccgcaacggggacaaggccgcgccccgcgag
tacacagctggcagggaagcagatgatattgtcagctggctgaagaagcgcacgggaccg
gctgccactaccctgacagatgctgctgcagcagagacgttggtggattccagtgaagtg
gttgtgattggtttctttaaggatgtgacatcagatgctgcgaaggagtttttgttggca
gcagaatccgtggatgacattccttttgggatttcttccagcgctgacgtcttctccaag
taccagcttagccaagatggagtggtccttttcaagaagtttgatgaaggacgtaacaac
tttgaaggggatcttaccaaagataacttgctgaacttcatcaagtctaatcagctgcct
cttgtcatagagtttactgagcagactgctcctaaaatctttggaggagagatcaagact
cacattctgctgttcttaccaaaaagtgtgtctgattatgaagggaaattggacaacttc
aagactgcagctggaaacttcaaagggaagatcctgttcatcttcatagacagtgaccac
agtgataatcaaaggattctggagttttttggtctaaagaaagaagaatgtccagctgta
cgtttgataacattagaagaagaaatgaccaaatacaaacctgagtcagatgacctcaca
gcagacaagatcaaagaattctgtaataaattcctggagggcaagatcaagcctcacctg
atgagccaggatctccctgaagactgggacaagcagcctgtcaaagttcttgttgggaag
aattttgaggaagttgcttttgatgagaataagaatgtctttgtggagttctatgccccc
tggtgtggtcactgtaagcagctggctccgatctgggacaagctgggagagacctacaga
gaccatgagaacattgtcattgccaagatggattcaacagccaatgaagtagaggcagtg
aaaattcacagcttccccacgctcaagttcttccctgcaggctctggcagaaacgtaatt
gactataatggagagaggacactagaaggcttcaaaaaattcttggagagtggaggccag
gatggagcagcagctgatgatgatctggaagatctggagacagatgaagaaacggacctt
gaggaaggtgatgatgatgagcaaaaaatccaaaaggatgaattgtaa

DBGET integrated database retrieval system