KEGG   Gallus gallus (chicken): 374091Help
Entry
374091            CDS       T01006                                 

Gene name
P4HB, PDI
Definition
prolyl 4-hydroxylase, beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    374091 (P4HB)
Enzymes [BR:gga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     374091 (P4HB)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   374091 (P4HB)
  Exosomal proteins of colorectal cancer cells
   374091 (P4HB)
  Exosomal proteins of bladder cancer cells
   374091 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
18
AA seq 515 aa AA seqDB search
MAVVRVRAIVALLCLVAALGLAQPLEEEDGVLVLRAANFEQALAAHRHLLVEFYAPWCGH
CKALAPEYAKAAAQLKAEGSEIRLAKVDATEEAELAQQFGVRGYPTIKFFRNGDKAAPRE
YTAGREADDIVSWLKKRTGPAATTLTDAAAAETLVDSSEVVVIGFFKDVTSDAAKEFLLA
AESVDDIPFGISSSADVFSKYQLSQDGVVLFKKFDEGRNNFEGDLTKDNLLNFIKSNQLP
LVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLDNFKTAAGNFKGKILFIFIDSDH
SDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDDLTADKIKEFCNKFLEGKIKPHL
MSQDLPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQLAPIWDKLGETYR
DHENIVIAKMDSTANEVEAVKIHSFPTLKFFPAGSGRNVIDYNGERTLEGFKKFLESGGQ
DGAAADDDLEDLETDEETDLEEGDDDEQKIQKDEL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggtgcgcgtgcgcgcgatcgtagcgctgctctgcctcgtggccgccctcggc
ctggcgcagccgctggaggaggaggacggcgtcctggtgctgcgcgccgccaacttcgag
caggccctggcggcgcaccgccacctgctcgtggagttctacgcgccgtggtgcgggcac
tgcaaggcgttggccccggagtacgcgaaggcggcggcgcagctgaaggcggagggttcc
gagatccgcctggccaaggtggacgccacggaggaggcggagctggcgcagcagttcggc
gtgcgcgggtaccccaccatcaagttcttccgcaacggggacaaggccgcgccccgcgag
tacacagctggcagggaagcagatgatattgtcagctggctgaagaagcgcacgggaccg
gctgccactaccctgacagatgctgctgcagcagagacgttggtggattccagtgaagtg
gttgtgattggtttctttaaggatgtgacatcagatgctgcgaaggagtttttgttggca
gcagaatccgtggatgacattccttttgggatttcttccagcgctgacgtcttctccaag
taccagcttagccaagatggagtggtccttttcaagaagtttgatgaaggacgtaacaac
tttgaaggggatcttaccaaagataacttgctgaacttcatcaagtctaatcagctgcct
cttgtcatagagtttactgagcagactgctcctaaaatctttggaggagagatcaagact
cacattctgctgttcttaccaaaaagtgtgtctgattatgaagggaaattggacaacttc
aagactgcagctggaaacttcaaagggaagatcctgttcatcttcatagacagtgaccac
agtgataatcaaaggattctggagttttttggtctaaagaaagaagaatgtccagctgta
cgtttgataacattagaagaagaaatgaccaaatacaaacctgagtcagatgacctcaca
gcagacaagatcaaagaattctgtaataaattcctggagggcaagatcaagcctcacctg
atgagccaggatctccctgaagactgggacaagcagcctgtcaaagttcttgttgggaag
aattttgaggaagttgcttttgatgagaataagaatgtctttgtggagttctatgccccc
tggtgtggtcactgtaagcagctggctccgatctgggacaagctgggagagacctacaga
gaccatgagaacattgtcattgccaagatggattcaacagccaatgaagtagaggcagtg
aaaattcacagcttccccacgctcaagttcttccctgcaggctctggcagaaacgtaatt
gactataatggagagaggacactagaaggcttcaaaaaattcttggagagtggaggccag
gatggagcagcagctgatgatgatctggaagatctggagacagatgaagaaacggacctt
gaggaaggtgatgatgatgagcaaaaaatccaaaaggatgaattgtaa

DBGET integrated database retrieval system