KEGG   Gallus gallus (chicken): 374207Help
Entry
374207            CDS       T01006                                 

Gene name
HDAC4
Definition
histone deacetylase 4 (EC:3.5.1.98)
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     374207 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
7
AA seq 1080 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPPRVNHMPSSVDVSTALPLQVAPTSVPMDLRLDHQFPMP
VTEPTLREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQEMLAM
KHQQELLEHQRKLEQHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLN
KKKALAHRNLNHCISSDPRFWYGKTQHSSLDQSSPPQSGVSGTYNHPVLGMYDSKDDFPL
RKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACNSAPGSGPS
SPNNSSNNISAENGITGSVTSIQAETSLAHRLVNREGSVTQLPLYTSPSLPNITLGLPAT
GPSSGGSAQQDAERLAIPALQQRISLFPGTHLTPYLSTTTLERDGGTAHNPLLQHMVLLE
QPTAQTPLVTGLPLHAQSLVGGERVSPSIHKLRQHRPLGRTQSAPLPQNAQALQQLVIQQ
QHQQFLEKHKQQFQQQQLHINKIISKPNEPARQHESHPEETEEELREHQALLEEPYSDRV
SSQKEVPGLANMVQVKQEPIESDEEEAEPQQELESGQRQAEQELLFRQQALLLEQQRIHQ
LRNYQASLEAAGMPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTLMLK
HQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYG
TNPLNRQKLDSKKLLGSLTSMFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVIELVFK
VATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHHG
NGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGAGVGFNVNMAFTGGLDPPMGD
TEYLTAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLA
GGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRANANAVHSMEKVIEIH
SKYWHSLQRYASTVGYSLVEAQKCENEEAETVTAMASLSVGVKPAEKRPDDEPMEEEPPL
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggcagagaccagccagtagagctgttg
aatccacctcgagtgaaccacatgcccagttctgttgatgtgagcacagcactgcccttg
caagttgccccaacctcagtcccaatggatctgcgcctggaccaccagttccctatgccc
gtgacagagccgacgctccgtgagcagcagctgcagcaggagctcctggcgctgaagcag
aagcagcagatccagaggcagatcctcattgctgagttccagcgacagcacgagcagctc
tcccggcagcacgaggcccagctgcacgagcacatcaagcagcaggagatgctggcaatg
aagcatcagcaggagctactggagcaccagaggaagctggagcagcaccggcaggagcag
gagctggagaagcagcaccgggagcagaaacttcaacagctgaaaaacaaagagaaaggc
aaggagagtgcagtggcaagcacagaagtaaagatgaaattacaagaatttgtcttaaat
aagaagaaggctttggcacaccggaatctcaaccactgcatttccagtgatcctcgcttc
tggtatgggaagacacagcacagctccctggaccagagctccccacctcaaagtggcgta
tccggcacctacaatcaccctgtcctggggatgtacgattccaaagatgacttcccactc
agaaaaacagcgtctgaacccaacctgaaattacgatccaggctaaagcaaaaagttgct
gagaggcggagcagccccctgttgcgcaggaaggatggccccgtggtcactgctctgaag
aagcgcccgctggatgtcacagactctgcatgcaacagtgctcctggatctggtcccagc
tctccaaacaacagctccaataacataagcgctgagaatggaattacaggatcagtcacg
agtattcaagcggagaccagcctggctcaccgactggtgaatcgcgaaggttcggtaaca
cagcttccactctacacatctccttctttgcccaacatcacactaggactgcctgcaact
ggcccttccagcggaggatcagcacagcaggatgctgagagacttgctatcccagccttg
cagcagcggatctctttatttcctggcacccacctcactccctacttgagcactacaacg
ttggaaagagatgggggaaccgcacacaaccctcttctgcagcacatggtcttactggag
cagccaactgcacaaactcccttagtcacaggactgcccctccatgcacagtctctggtt
ggtggagaacgggtctccccttcaatacacaaactccgacagcatcgcccactggggcgc
acgcagtctgctccccttccccagaacgcccaggccctccagcagttagtgatccagcag
cagcaccagcagttcttggagaaacacaaacagcaattccagcaacaacaactgcacatc
aacaagataatatcaaaacccaacgagccagctcgccagcatgaaagccacccggaggag
acagaagaagagcttcgagaacaccaagcccttttggaggagccatacagtgacagagtc
tcaagccaaaaggaggtcccagggctggccaatatggtgcaggtgaagcaagaacccatc
gagagcgatgaggaggaagctgagccacagcaggagctggagtctgggcagaggcaggct
gagcaggagctgctcttccgccagcaagccctcctgttggagcagcagcgcattcaccag
ctgagaaactaccaggcatcactggaggcagctggcatgcctgtctcctttggaggccat
cggcccctgtcccgtgcacagtcctcacccgcctcagccaccttccctatgtccgtacag
gagccacccactaagccaaggttcactacaggccttgtctatgacaccttgatgctgaaa
catcagtgtacctgtggaaacacaaacagccacccagagcacgcggggaggatccagagc
atctggtcccggctgcaggagacaggtctccgtggcaagtgcgagtgcattcgtggaaga
aaagcaactctagaagagctgcagacagttcactcggaagctcatacactgctgtacggc
acaaaccctctgaacagacagaaactggacagcaagaaacttctaggttctctaacgtcg
atgtttgtcaggcttccttgcggtggtgtcggggtcgacagtgacacaatctggaacgaa
gttcactcatccggtgctgctcgcctggctgtgggctgcgtcattgagcttgttttcaaa
gtggccacaggagaactgaagaatggatttgctgttgttcggcctccaggtcaccatgca
gaagaaagcacacccatgggcttctgctattttaactccgtggcaattgcagccaagctg
ctccagcaaagactgaatgttagcaaaatcctcatagtggactgggatgtacaccatggg
aacggtactcagcaagctttctacaatgatcctaatgttctttatatttcactacatcgc
tatgatgatgggaacttctttccaggcagtggtgctcctgatgaggttggcacaggagca
ggagttgggttcaatgttaacatggcatttactggtggccttgatccaccgatgggagac
acagagtacttgactgctttcagaacggtcgtaatgcccattgccaatgagtttgcccca
gatgttgtgctcgtgtcatctggttttgacgcagtggaaggccatcctacgcctctggga
ggatacaatctctctgcaaaatgctttgggtacctgacgaagcagctgatgggcctggct
ggaggccgcgtcgtcctggccctcgaaggaggccacgacctgactgccatttgcgatgcc
tcagaagcatgtgtttctgctttgctgggaaacgagcttgaccctcttccagaaaaggtt
ctccagcagagagcaaatgctaatgcggtgcattcaatggagaaagtgattgagatacac
agcaagtattggcattcactccagcgctacgcctccacagtgggctactccctggttgag
gcacagaagtgtgagaatgaagaggctgagacagtgacagccatggcatctctgtcggta
ggcgtgaagccagctgagaagcgacctgatgatgaacccatggaagaggaacctcccctg
tag

DBGET integrated database retrieval system