KEGG   Gallus gallus (chicken): 374232Help
Entry
374232            CDS       T01006                                 

Gene name
KAT2A, GCN5L2
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:gga04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Position
27
AA seq 783 aa AA seqDB search
MEQRGAGLSPVLGHRRPQSGAVPALTGGDLWPKRVKPLSRLLAASCIGLLCDGLSHPSSQ
ANDACKCNGWKNPNPPTAPRMDLQQPVTNLSEPCRSCSHALADHVSHLENVSEEEINRLL
GMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSQPVVEGSLGSPPFEKPNIEQ
GVLNFVQYKFSHLPPKERQTMYELSKMFLLCLNYWKLETPSQFRQRSQNDDVATYKVNYT
RWLCYCHVPQSCDSLPRYETTHVFGRSLLKSIFTVTRRQLLEKFRVEKDKLVPEKRTLIL
THFPKFLSMLEEEIYGENSPIWEADFTVPAAEGAQLVSRSATVSAVTVPTAPLFSKKLSS
SSLATSMDAGTPEPLPGEKRKLPESLTLEDAKRIRVMGDIPMELVNEVMLTITDPAAMLG
PETSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRM
PKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHL
MNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECE
LNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLTCFKEGVRQIPIESVPGIRET
GWKPLGKEKGKELKDPDQLYNTLKNLLAQIKTHPSAWPFMEPVKKSEAPDYYEIIRFPID
LKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPDSDYCKCANTLEKFFYFKLKEGGL
IDK
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcgcggggccgggctgagcccggtgctggggcaccgccggccgcagagcggg
gctgtgccggccctgacggggggggatctctggccaaagcgtgtgaagccgctcagccgt
ttgttggctgcgtcgtgcattgggctgctgtgcgatggcctctcccacccctcctcgcag
gctaacgatgcctgcaagtgcaacggctggaagaaccccaaccctcccaccgccccccgc
atggacctgcagcagccggtgaccaacctgagcgagccctgccgcagctgcagccacgcg
ttggccgaccacgtgtcccacctggagaacgtctcggaggaggagatcaaccgactgctg
ggcatggtggtggacgtggagaacctcttcatgtcagtgcacaaggaggaggacacggac
accaagcaggtctatttctacctgttcaagctcctcaggaagtgcatcctgcagatgagc
cagccggtggttgaggggtcgctggggagccccccatttgagaaacccaacattgagcag
ggggtcctgaacttcgtgcagtacaaattcagccacctcccgcccaaggagcggcagacg
atgtatgagctctccaagatgttcctgctctgcctcaactactggaagctggagacaccg
tcgcagttccggcagcgctcgcagaacgacgacgtggccacctacaaagtcaactacacc
aggtggctgtgctactgccacgtgccgcagagctgcgacagccttccccgctatgagacc
acgcacgtctttgggcgcagcctcctcaagtccatcttcactgtcacccgccggcagctg
ctggagaagttccgggtggagaaggacaagctggtgccggagaagcgcacgctgatcctc
acccacttccccaagttcctgtccatgctggaggaggagatctatggtgagaactcaccc
atatgggaggcggatttcactgtgccggctgcagagggcgcccagctggtgtcacgctca
gccaccgtcagtgccgtcacggtgcccaccgcaccgctcttcagcaagaagctcagcagc
agcagcttggccacgagcatggatgccggcacgccggagcctctgccgggggagaagcgg
aagctgccagagagcctgacgctggaggatgccaagaggatccgcgtgatgggcgacatc
cccatggagctggtgaacgaggtgatgctgaccatcaccgaccccgctgccatgctgggc
cctgagaccagcctgttgtcggccaacgcggcgcgggatgagaccgcccggctggaggag
cgccgcggcatcatcgagttccacgtcatcggcaactcgctctcgcagaagtccaacaag
aagatcctgatgtggctggtgggcctgcagaacgtcttctcgcaccagctgccccgcatg
cccaaggagtacatcacccgcctcgtcttcgacccgaagcacaagaccttggcactcatc
aaggatggccgtgtgatcgggggcatctgcttccgcatgtttcccacccagggcttcact
gagattgtcttctgcgccgtgacatccaatgagcaagtgaagggctacgggacacacctg
atgaaccacctgaaggagtaccacatcaagcacaacatcctctacttcctcacctatgcc
gatgagtatgccattggctacttcaagaagcagggcttctctaaggacatcaaggtcccc
aagagccgctacctgggctacatcaaggactacgagggggcaaccttgatggagtgcgag
ctgaacccccgcatcccctatactgagctttcccacatcatcaaaaagcagaaggagatc
atcaagaagctgattgagaggaagcaagcgcagatccgcaaggtctaccctggcctgacc
tgcttcaaggagggcgtgcggcagatccccatcgagagcgtccccggcatccgagaaacg
ggttggaaaccgctggggaaggagaaagggaaggagctgaaggacccggaccagctctac
aacaccctgaagaacctcctggcccagatcaagacccaccccagcgcgtggcccttcatg
gagccggtgaagaaatcggaggcgccggactactatgaaatcatccgcttccctattgac
ctgaagaccatgacggagcgcctgaagaaccgctactacgtcaccaagaagctgttcatt
gccgacctgcagcgcatcatcaccaactgccgcgagtacaacccgcccgacagcgactac
tgcaagtgtgccaacaccctggagaagttcttctacttcaagctgaaggaaggggggctc
atcgacaagtag

DBGET integrated database retrieval system