KEGG   Gallus gallus (chicken): 374232Help
Entry
374232            CDS       T01006                                 

Gene name
KAT2A, GCN5L2
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    374232 (KAT2A)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     374232 (KAT2A)
Transcription machinery [BR:gga03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     374232 (KAT2A)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    374232 (KAT2A)
   HAT complexes
    PCAF complex
     374232 (KAT2A)
    STAGA complex
     374232 (KAT2A)
    TFTC complex
     374232 (KAT2A)
    SAGA complex
     374232 (KAT2A)
    SLIK complex
     374232 (KAT2A)
    ADA-HAT complex
     374232 (KAT2A)
    HAT-A2 complex
     374232 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
27
AA seq 783 aa AA seqDB search
MEQRGAGLSPVLGHRRPQSGAVPALTGGDLWPKRVKPLSRLLAASCIGLLCDGLSHPSSQ
ANDACKCNGWKNPNPPTAPRMDLQQPVTNLSEPCRSCSHALADHVSHLENVSEEEINRLL
GMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMSQPVVEGSLGSPPFEKPNIEQ
GVLNFVQYKFSHLPPKERQTMYELSKMFLLCLNYWKLETPSQFRQRSQNDDVATYKVNYT
RWLCYCHVPQSCDSLPRYETTHVFGRSLLKSIFTVTRRQLLEKFRVEKDKLVPEKRTLIL
THFPKFLSMLEEEIYGENSPIWEADFTVPAAEGAQLVSRSATVSAVTVPTAPLFSKKLSS
SSLATSMDAGTPEPLPGEKRKLPESLTLEDAKRIRVMGDIPMELVNEVMLTITDPAAMLG
PETSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRM
PKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHL
MNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECE
LNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLTCFKEGVRQIPIESVPGIRET
GWKPLGKEKGKELKDPDQLYNTLKNLLAQIKTHPSAWPFMEPVKKSEAPDYYEIIRFPID
LKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPDSDYCKCANTLEKFFYFKLKEGGL
IDK
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcgcggggccgggctgagcccggtgctggggcaccgccggccgcagagcggg
gctgtgccggccctgacggggggggatctctggccaaagcgtgtgaagccgctcagccgt
ttgttggctgcgtcgtgcattgggctgctgtgcgatggcctctcccacccctcctcgcag
gctaacgatgcctgcaagtgcaacggctggaagaaccccaaccctcccaccgccccccgc
atggacctgcagcagccggtgaccaacctgagcgagccctgccgcagctgcagccacgcg
ttggccgaccacgtgtcccacctggagaacgtctcggaggaggagatcaaccgactgctg
ggcatggtggtggacgtggagaacctcttcatgtcagtgcacaaggaggaggacacggac
accaagcaggtctatttctacctgttcaagctcctcaggaagtgcatcctgcagatgagc
cagccggtggttgaggggtcgctggggagccccccatttgagaaacccaacattgagcag
ggggtcctgaacttcgtgcagtacaaattcagccacctcccgcccaaggagcggcagacg
atgtatgagctctccaagatgttcctgctctgcctcaactactggaagctggagacaccg
tcgcagttccggcagcgctcgcagaacgacgacgtggccacctacaaagtcaactacacc
aggtggctgtgctactgccacgtgccgcagagctgcgacagccttccccgctatgagacc
acgcacgtctttgggcgcagcctcctcaagtccatcttcactgtcacccgccggcagctg
ctggagaagttccgggtggagaaggacaagctggtgccggagaagcgcacgctgatcctc
acccacttccccaagttcctgtccatgctggaggaggagatctatggtgagaactcaccc
atatgggaggcggatttcactgtgccggctgcagagggcgcccagctggtgtcacgctca
gccaccgtcagtgccgtcacggtgcccaccgcaccgctcttcagcaagaagctcagcagc
agcagcttggccacgagcatggatgccggcacgccggagcctctgccgggggagaagcgg
aagctgccagagagcctgacgctggaggatgccaagaggatccgcgtgatgggcgacatc
cccatggagctggtgaacgaggtgatgctgaccatcaccgaccccgctgccatgctgggc
cctgagaccagcctgttgtcggccaacgcggcgcgggatgagaccgcccggctggaggag
cgccgcggcatcatcgagttccacgtcatcggcaactcgctctcgcagaagtccaacaag
aagatcctgatgtggctggtgggcctgcagaacgtcttctcgcaccagctgccccgcatg
cccaaggagtacatcacccgcctcgtcttcgacccgaagcacaagaccttggcactcatc
aaggatggccgtgtgatcgggggcatctgcttccgcatgtttcccacccagggcttcact
gagattgtcttctgcgccgtgacatccaatgagcaagtgaagggctacgggacacacctg
atgaaccacctgaaggagtaccacatcaagcacaacatcctctacttcctcacctatgcc
gatgagtatgccattggctacttcaagaagcagggcttctctaaggacatcaaggtcccc
aagagccgctacctgggctacatcaaggactacgagggggcaaccttgatggagtgcgag
ctgaacccccgcatcccctatactgagctttcccacatcatcaaaaagcagaaggagatc
atcaagaagctgattgagaggaagcaagcgcagatccgcaaggtctaccctggcctgacc
tgcttcaaggagggcgtgcggcagatccccatcgagagcgtccccggcatccgagaaacg
ggttggaaaccgctggggaaggagaaagggaaggagctgaaggacccggaccagctctac
aacaccctgaagaacctcctggcccagatcaagacccaccccagcgcgtggcccttcatg
gagccggtgaagaaatcggaggcgccggactactatgaaatcatccgcttccctattgac
ctgaagaccatgacggagcgcctgaagaaccgctactacgtcaccaagaagctgttcatt
gccgacctgcagcgcatcatcaccaactgccgcgagtacaacccgcccgacagcgactac
tgcaagtgtgccaacaccctggagaagttcttctacttcaagctgaaggaaggggggctc
atcgacaagtag

DBGET integrated database retrieval system