KEGG   Gallus gallus (chicken): 374234Help
Entry
374234            CDS       T01006                                 

Gene name
SPTAN1, SPECA
Definition
(RefSeq) spectrin, alpha, non-erythrocytic 1
  KO
K06114  
spectrin alpha
Organism
gga  Gallus gallus (chicken)
Brite
Cytoskeleton proteins [BR:gga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     374234 (SPTAN1)
  Intermediate filaments
   Intermediate filament-binding proteins
    374234 (SPTAN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
17
AA seq 2477 aa AA seqDB search
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSSLRRQKLEDSYRFQFFQRDADELGKWI
QEKLQIASDENYKDPSNLQGKLQKHQAFEAEVQANSGAIVKLDETGNQMINEGHFASETI
RTRLQELHRLWELLLEKMREKGVKLLQAQKLVQFLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDLAAHEERVNEVNQFAGKLIQEQHPEEELIKSKQDEVNASWQRL
KGLAQQRQGKLFGAAEVQRFNRDVDETISWIKEKGQLMASDDFGRDLASVQALLRKHEGL
ERDLAAFHHKVKALCAEADRLQQSHPINASQIQVKREELIANWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFRSA
DESGQALLAAGHYASDEVKEKLTILSDERSALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MDDVATRRDALLSRRNALHERAMKRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYASDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTSVQNLQKKH
ALLEADVAAHQDPIDGITIQARQFQDAGHFDADNIKKKQEALVARYEALKDPMVARKQKL
ADSLRLQQLFRDIEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKIKLNELNQKWDSLKAKASQRRQDLEDSLQAQQYFADAN
EAQSWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPAQSASRENLLEEQGSIALRQEQIDNQTLITKEVGSVSLRMKQVEELYHSLLELG
EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTNEEVGADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVANDLESEGLMAEEVQAVEHQEVYGMMPRDETDSKTVSPWKSARMMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSADEVQRFHRDADETKEWIEEKNQALNTDN
YGHDLASVQALQRNDEGFERDLAALGDKVNSLGETAQRLIQSHPELAEDLQEKCTELNQA
WSSLGKRADQRKEKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLER
HQEHRTEIDARAGTFQAFEQFGQQLLARGHYASPEIKEKLDILDQERTDLEKAWVQRRMM
LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK
IAVLQSFADQLIAADHYAKGVIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDV
DEIEAWISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIEMGNP
LIERGACAGSEDAVKARLAALADQWEFLVQKSSEKSQKLKEANKQQNFNTGIKDFDFWLS
EVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQV
KDKRETINGRFQRIKSMAAARRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRD
LTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVDHWKEL
KQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAF
ETDFTVHKDRVNDVCANGEDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAKLDEN
SAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIAN
ITALKDQLLAAKHIQSKAIEVRHASLMKRWNQLLANSAARKKKLLEAQEHFRKVEDLFLT
FAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDR
QIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHAN
AFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEA
LILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHF
DKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFESILDTVDPNRDGHVSLQEYMAFM
ISRETENVKSSEEIESAFRALSSERKPYVTKEELYQNLTREQADYCISHMKPYMDGKGRE
LPSAYDYIEFTRSLFVN
NT seq 7434 nt NT seq  +upstreamnt  +downstreamnt
atggatccaagtggggtaaaagtgttggaaacagcagaagatatccaagaacggcgtcag
caggttttggaccgttaccacaggttcaaggagctgtcttctctgaggcgccaaaaactc
gaagattcctatcggttccagttcttccagcgtgatgcagatgagctgggaaaatggatc
caagagaaactccagatagcatctgatgaaaattacaaagacccaagcaatttacagggg
aagctgcagaagcaccaggcctttgaagctgaggtgcaggccaattcaggggctatcgtt
aagctggatgagactggaaatcagatgatcaatgaaggccattttgcatctgaaaccata
agaactcgtctacaggagctgcaccgactatgggagttactgctggaaaaaatgagagag
aagggagtgaagctgttgcaagcacagaagctggtgcaattcttacgggaatgtgaagat
gtcatggactggatcaatgacaaggaagcaatagtgacctcagaagagcttggacaggac
ttagagcatgttgaggttttgcagaagaaatttgaagagttccaaacagatctggcagct
catgaggagagagtgaatgaagtgaaccagttcgctgggaaacttatccaggaacagcac
cctgaggaggaacttataaagtccaaacaggatgaagtaaatgcaagctggcagcgtctt
aaggggcttgcccaacagaggcaaggaaaactctttggggcagctgaagttcagcgcttc
aacagggatgtggatgaaactatcagctggattaaggagaaagggcagttgatggcctca
gatgactttggcagagacttggccagcgtgcaagctttactacgtaagcatgaaggcctg
gaaagagatcttgcagctttccaccataaggttaaggccctctgtgcagaagctgaccgt
ttgcagcaatctcaccctataaatgcttctcaaattcaagtgaaacgggaggaactgatt
gccaactgggagcagatccgaactctggcagcagagaggcatgctcgccttaatgactcc
tacaggttgcagcgctttcttgcagatttccgggacctcactagctgggtaactgagatg
aaggctctgataaatgctgatgagcttgccaatgatgtggctggagcagaagcccttcta
gatagacatcaggaacataagggagaaattgatgctcatgaggatagcttcagatctgct
gatgagtctgggcaggctttgcttgcagctgggcactatgcttctgatgaagttaaagaa
aagctgactatcctctcagatgaaagatctgccttgctggaactatgggagcttcgcagg
caacagtatgagcagtgcatggatctgcagcttttctacagagatactgaacaagttgac
aactggatgagcaaacaagaagcttttctgctgaacgaagaccttggtgattctctggat
agcgtggaggctcttctaaagaagcatgaagattttgagaaatccctaagtgctcaagag
gagaaaatcacagcactggatgagtttgctactaaactgattcaaaataaccattatgcc
atggatgacgttgctacgcgcagagatgctcttctgagtcgccgaaatgctcttcatgaa
agagccatgaagcgccgtgcccaactggcagactctttccatctccagcagtttttcagg
gactctgatgaactgaagagttgggttaatgaaaaaatgaaaactgctaccgatgaggct
tacaaggatccatccaacttgcaaggtaaagttcagaagcatcaggcttttgaagcagag
ctttctgctaatcagagtcgtattgatgcactggagaaagctggccagaagttgattgat
gtcaatcactatgcatctgatgaggtggcagctcgcatgaatgaagtcatcagcttgtgg
aagaaacttctggaagccaccgagctcaaaggtataaagctgcgtgaagccaatcaacag
cagcaatttaatcgcaatgtagaagacattgagttgtggctgtatgaagtggagggtcac
ttggcttctgatgattatggaaaagatcttaccagcgttcagaatcttcagaagaaacat
gccctgctagaggcagatgttgctgcccatcaggatccgatagatggcattaccatccag
gcacgccagttccaagatgctgggcactttgatgctgacaatatcaagaagaaacaagaa
gctttagtagctcgttatgaagctctgaaggatcctatggtggctcgcaagcagaaactt
gcagattctcttcgcctgcagcagcttttccgtgacatcgaggatgaagagacctggatc
agggaaaaggaacctattgcagcctcaacaaaccgaggcaaggacttaattggtgtccag
aatctgctaaagaagcaccaggctttgcaggcagaaattgcaggccatgagcctcgcatt
aaagcagtcacacaaaaaggaaatgcgatggtggaagagggacattttgctgctgaagat
gtgaagatcaaattgaatgaactaaaccaaaaatgggactctctgaaagcgaaggcatct
caacggcgacaggatctagaggattctctgcaagctcagcagtattttgctgatgctaat
gaggcacaatcatggatgagggaaaaggagcccattgtaggcagcacggattatggaaag
gatgaagactctgctgaggctctcctgaagaagcatgaagctttgatgtctgatctttct
gcttacggcagtagcatacaggcattaagggaacaggcccagtcctgcaggcaacaagtt
gctcccactgatgatgaaactggaaaagagcttgtgctagcactctatgattaccaagag
aagagtcctcgggaggtgactatgaagaaaggagatattctaaccctgctcaacagcacc
aacaaggactggtggaaggttgaagttaacgatcgtcagggctttgtaccagctgcctat
gtgaaaaaactagatcctgcccagtctgcatcccgagagaatcttctggaagagcaaggc
agcatagcattgcgacaggagcaaattgacaaccagactctcattactaaggaagtcggc
agtgtatctctgcgtatgaaacaggtcgaagaactgtatcattcccttcttgagctggga
gaaaaacgtaaaggcatgctagaaaaaagctgcaagaagtttatgcttttccgtgaggct
aatgagcttcaacagtggatcaatgagaaggaagctgcactcactaacgaggaagtgggt
gctgatttggagcaggtggaggtgctacagaagaagtttgatgattttcagaaggattta
aaagctaatgagtcacgactgaaggacataaacaaggttgcaaatgatctggagtctgaa
gggctgatggcagaggaagtgcaagcagtagagcaccaggaagtctatggaatgatgccc
agagatgaaactgattctaagacagtctctccttggaagtctgcacgtatgatggtacac
acggtggcaacatttaactcaattaaggaactgaatgaacgctggagatccctgcagcag
ttggcagaggagcgaagccagctgttgggcagcgctgatgaagtccagaggttccacaga
gatgctgatgaaacaaaagaatggatagaagagaagaatcaagcattaaataccgacaac
tatggacatgacttggccagtgtgcaggctctgcagcgcaacgatgaaggctttgagaga
gacttggcagctcttggagacaaggtgaattctcttggtgaaactgcccagcgtctgatc
cagtcacatccagaactagctgaagatcttcaagaaaaatgtactgagttgaaccaagcc
tggagtagtctgggaaaacgtgctgaccaacgcaaagagaagcttggagattctcatgac
ctgcagcgtttcctcagtgattttagagaccttatgtcttggatcaatggaatccggggt
ctggtctcctcagatgaacttgcaaaagatgtgactggagctgaagctctgttggaaagg
catcaggagcaccgtactgaaatagatgcacgggctggcacttttcaggcatttgaacag
tttggacagcagcttctggctcgtggacactatgccagcccagagattaaggagaaactg
gatattctagatcaagaacggacagacctagagaaggcctgggtccagcgcagaatgatg
ctagaccagtgcttagaactacagctgtttcatcgggattgtgaacaagctgaaaactgg
atggctgcccgagaggcgttcctaaatacagaagacaaaggagactccttagacagcgtg
gaggcactcatcaagaagcatgaagatttcgataaagcaatcaatgtccaggaagagaaa
attgctgtcttgcagtcttttgctgaccaactgattgctgctgatcattatgcaaaagga
gtcattgctaacagacgcaatgaggttctggacaggtggcgtcgtctgaaggctcagatg
attgagaagagatctaagctgggagaatctcagaccctccaacagttcagtcgtgatgtt
gatgaaatagaagcttggatcagtgaaaagcttcaaactgcaagtgatgagtcatataag
gatcccacaaacatccagctttccaaactgctgagcaagcaccagaagcaccaagccttt
gaagctgagctccacgccaacgcagatcggattcgtggagtcattgaaatggggaaccct
cttattgaaagaggagcgtgtgctggcagcgaggatgctgtgaaggctcggctggctgcc
ctggctgaccaatgggagttcctggtccagaagtcatcagagaagagtcagaaactgaaa
gaagcaaataaacagcagaatttcaataccggcatcaaggactttgatttctggctttca
gaggtggaagctttgttggcatctgaagactatgggaaggacttggcatcagtgaacaac
cttctgaagaagcaccaattactggaagctgatatatctgctcatgaggatcggctgaag
gacctgaacagccaggctgacagtttgatgaccagcagtgctttcgatacctcccaagta
aaggataaacgtgaaactataaatgggcgcttccagagaatcaagagcatggcagctgcc
cgccgtgcgaagctcaacgagtcgcaccgcttgcatcagttcttccgtgacatggatgat
gaggagtcctggatcaaagagaagaaactgttggtgagctcagaggactatggcagagac
ctgactggtgtgcagaacctgaggaagaaacataagcgcttggaagcagaattagctgcc
catgaacctgctatccagggtgttctagacactggcaagaagctttcagatgataacaca
attgggaaggaggagatacagcaaagactggctcagtttgtggaccactggaaagagtta
aaacagctggcagctgctcgggggcaacgtctggaggagtccctggagtaccaacagttt
gtagcaaatgttgaggaagaggaggcatggatcaacgagaaaatgacattggtagccagt
gaggattatggagacacacttgctgctatccagggcttgctgaagaagcatgaagcattc
gagactgactttactgtccacaaagacagagtgaatgatgtttgtgctaatggagaggat
ctcattaaaaagaataatcaccatgtggagaacattactgctaagatgaagggcctcaag
ggcaaggtatcagatctggagaaagccgcagctcagaggaaagccaaactggatgagaac
tctgccttcctccagttcaactggaaagcagatgtggtggagtcatggataggtgagaag
gaaaacagcctgaagacagatgattatggccgtgacctctcctctgtgcaaacactactc
accaaacaggaaacctttgatgctggacttcaggctttccagcaggagggaattgcaaac
atcactgctctgaaagaccagctactggcagccaaacatatccaatcaaaggccattgag
gttcgtcacgcttccttgatgaaacgctggaatcagctgcttgctaattctgcagccagg
aaaaagaaactcttggaggctcaggagcacttcagaaaggttgaagatctcttcttgact
tttgccaagaaggcctctgccttcaacagttggtttgagaatgctgaggaggacctgacg
gatcccgtgcgctgcaattccctggaagaaatcaaagcactgcgagaagcccacgatgcc
ttccgttcctcacttagctctgcccaagctgacttcaaccagctggcagagcttgatcgg
cagatcaagagcttccgtgtagcctccaacccgtacacttggtttactatggaggctctt
gaagaaacttggaggaatctgcagaaaattatcaaggagcgtgaattggagttgcagaag
gagcagcggaggcaggaagaaaatgacaagttgcgccaggagtttgctcagcatgctaat
gccttccaccagtggattcaggagacaaggacttacctgctagatgggtcctgtatggtg
gaggagtcgggaacactggaatcccagctggaagctactaaacgcaagcaccaggagatc
cgggctatgaggagccagctgaagaagattgaggaccttggagcagccatggaagaggca
cttatcttggacaacaaatacacagagcacagcaccgtggggctggcgcagcagtgggac
cagcttgaccagctgggaatgagaatgcagcacaatctggaacagcagattcaagctcga
aacacaactggagtcacagaggaggccctgaaggagttcagcatgatgttcaagcacttt
gacaaggacaaatctggacgtcttaatcaccaggagtttaagtcttgcttgcgctccctt
ggctatgacctgcccatggttgaggaaggagagcctgaccccgaatttgagtctattctt
gacactgttgatcccaacagggatggccacgtctcgctgcaggagtacatggcgttcatg
atcagcagggaaacagagaacgtgaaatccagcgaggagattgagagtgctttccgtgcc
ctcagctcggagaggaagccttacgtgaccaaggaggagctctaccagaacctgacccgg
gagcaggccgactactgcatttctcacatgaagccctacatggatggcaagggcagagaa
cttccttctgcctacgactacatagaatttacacgttcactctttgtgaattga

DBGET integrated database retrieval system