KEGG   Gallus gallus (chicken): 378804Help
Entry
378804            CDS       T01006                                 

Gene name
PPP3R1
Definition
protein phosphatase 3, regulatory subunit B, alpha (EC:3.1.3.16)
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    378804 (PPP3R1)
   04310 Wnt signaling pathway
    378804 (PPP3R1)
   04370 VEGF signaling pathway
    378804 (PPP3R1)
   04020 Calcium signaling pathway
    378804 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    378804 (PPP3R1)
   04210 Apoptosis
    378804 (PPP3R1)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     378804 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggcaagctaccctttggaaatgtgctcgcactttgatgctgatgagatt
aaacggctaggaaagagatttaagaagcttgatttggacaactctggttctttgagcgtg
gaagagttcatgtctttacctgaattgcaacagaacccgttggtacagcgagtaatagat
atatttgacacagacggcaatggagaagtggacttcaaagaatttatagaaggagtctcc
cagttcagtgtcaaaggagataaggaacagaagttgaggtttgcttttcgcatctacgac
atggacaaagatggttatatctcaaatggcgagctcttccaggtgctgaagatgatggtg
gggaacaatctcaaagacactcagttacagcaaattgtagataaaaccataattaatgca
gataaggatggtgatggaagaatatcctttgaagaattctgtgctgttgtaggaggccta
gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system