KEGG   Gallus gallus (chicken): 378804Help
Entry
378804            CDS       T01006                                 

Gene name
PPP3R1, HZGJ
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
gga  Gallus gallus (chicken)
Pathway
gga04010  MAPK signaling pathway
gga04020  Calcium signaling pathway
gga04114  Oocyte meiosis
gga04218  Cellular senescence
gga04310  Wnt signaling pathway
gga04370  VEGF signaling pathway
gga04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    378804 (PPP3R1)
   04310 Wnt signaling pathway
    378804 (PPP3R1)
   04370 VEGF signaling pathway
    378804 (PPP3R1)
   04020 Calcium signaling pathway
    378804 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    378804 (PPP3R1)
   04218 Cellular senescence
    378804 (PPP3R1)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    378804 (PPP3R1)
Protein phosphatases and associated proteins [BR:gga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     378804 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 378804
NCBI-ProteinID: NP_989707
CGNC: 49127
Ensembl: ENSGALG00000023648
UniProt: Q6VN51
Position
3
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggcaagctaccctttggaaatgtgctcgcactttgatgctgatgagatt
aaacggctaggaaagagatttaagaagcttgatttggacaactctggttctttgagcgtg
gaagagttcatgtctttacctgaattgcaacagaacccgttggtacagcgagtaatagat
atatttgacacagacggcaatggagaagtggacttcaaagaatttatagaaggagtctcc
cagttcagtgtcaaaggagataaggaacagaagttgaggtttgcttttcgcatctacgac
atggacaaagatggttatatctcaaatggcgagctcttccaggtgctgaagatgatggtg
gggaacaatctcaaagacactcagttacagcaaattgtagataaaaccataattaatgca
gataaggatggtgatggaagaatatcctttgaagaattctgtgctgttgtaggaggccta
gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system