KEGG   Gallus gallus (chicken): 378913Help
Entry
378913            CDS       T01006                                 

Gene name
FLNB
Definition
filamin B, beta
Orthology
K04437  
filamin
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    378913 (FLNB)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    378913 (FLNB)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    378913 (FLNB)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   378913 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
12
AA seq 2567 aa AA seqDB search
MSTQARGQGGARAADPDGEMPATEKDLAEDAPWKRIQQNTFTRWCNEHLRCVNKRIGNLQ
HDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFWSGRASSWLSIDSKA
IVDGNLKLILGLIWTLILHYLISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNF
NQNWQDGKALGALVDSCAPGLCPDWETWDPSKPVDNAREAMQQADDWLGVPQLLPPEEII
HPDVDEHSVMTYLYTFPKAKLKPGAPLKPKLNPKKARAYGRGIEPHGNMVKQPAIFTVDT
ISAGQGDLMVFVEDPEGNREEAKIMPSSDKNKTYSVQYVPKVTGPHKVSVLFAGQHISKS
PFEVNVDKAQGDASKVTAKGPGLEATGNIANKPTYFDLYTAGAGVGDVIVEVEDPQGRCL
AEVAVEDKGNQVYRCVYKPVQAGPHVVKVTFAGEAIPKTPCSVLIGEACNPNACRATGRG
LQPKGVRIRETATQLIREQQAVETLGTIKTRLEELVKQKGFMDGVYAFEYYPATPGKYVV
TITWGGHNIPKSPFEVHIGHEAGPQKVRAWGPGLHEGIVGRSADFVVESIGTEVGSLGFA
IEGPSQAKIECDDKNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIRPASGDFNP
DKVRAYGPGLERSGCIVNNPAEFTVETKDAGKAPLKIYSQDGEGNPIDIQMKSKPDGVFA
CSYVPVKPIKHTISIVWGGANVPSSPFRVLIGQGSHPQKVKVFGPGVERTGLKASEPTHF
TVDCTDAGEGDVSVGIKCDARVVSDEEEDIDFDIIHNANDTFTVKYAPPAAGRYTIKVLF
AGEEIPASPFRVKVDPSHDASKVKVKLPGLSQNWCGKCKPTHFTVFTKGAGKAPLDVQFS
SPVPGEVVTDVDIIDNIDYSHTVRYTPIQQGPMKVLVTYGGDPIPKSPFTVGVAAPLDLS
KVKVNGLENRVEVGKDQEFVIDTRGAGGQGKLDVNISSPMRKAVPCLVEPVLGKECSTAK
YIPREEGLYVVDVSYDGNPIQAALYCGATLPPDPSKVKAHGPGLSRRPRWKTSSIHNIDT
KGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKA
DIEMPFDVSKVIATGPGLERGKVGEAGLLNVDCTEAGPGNLRVDMVSDTVSKAEIQIDDN
KDGTYVVTYVPLSAGMYTIKMKYGGEQVPKFPARVKVEPAVDTSRVKVFGPGVEGKDVFR
EATTDFTVDARPLTKAGGDHIRTQITSPSGSPTDCQIQDNADGTYAVEYTPFEKGPHTVN
VTYDGVPVPNSPFRVNVTEGCHPSRVKAQGPGLKEAFTNQPNAFSVVTRGAGIGGPGITV
EGPSESKISCKDNKDGSCSAEYVPYVPGDYDVNITYGGEHIPGSPFKVPVKDVVDPSKVK
IAGPGLGTAVRAKVPQSFTVDTSKAGVAPLEVVVAGPRGIVEPVNVVDNGDGTHTVCTPL
HRRDHTDLCQISDEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGIPASLPVEFAVDAKD
AGQGLLTVQITDQEGKPKRVDIHDNKDGTYTVTYVPDKTGRYTIGVKYGGDDIHPLPTES
ASPAGDAAQCLATGLGIAPTVRTGEEVGFVVDAKSAGKGKVTCTVLTPDGTEAEADVVEN
EDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMVTEEAYVPVGDMNGMGFRPFDMVI
PFAVRKGEITGEVHMPSGKTDTPDIVDNKDGTVTVRYAPTEVGLHEMHIKYMGNHIPESP
LQFYVNYPNSGSVSAYGPGLIYGVANKPATFTIVTEDAEEGGLDLAIEGPSKAEISCIDN
KDGTCTVTYLPTLPGNYSILVKYNDKHIPGSPFTAKITDDNRRRSQVKLGSAAEFLLDIN
ETDLSLLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVPNSPVT
IMVVQSEIGVARRARVYGRGLVEGRTFEMCDFIVDTRDAGYGGISLAVEGPSKVDIQTED
LEDGTCKVSYFPTVPGVYIVSTKFADEHIPGSPFTVKISGEGRVKESITRTRRAPSVATV
GSICDLNLKIPQIDCGDMTAQVTSPSGRNSDAEIVEVDKNTYCVRFVPQEMGVTRWMSNT
EGPVPGSPFQFTVGPLGEGGAHKVRAGAQGGAWREGVPAEFSIWTREAGAGGLSIAVEGP
SKAEIAFEDHKDGSCGVSYIVQEPGNYEVSIKFNDEHIPESPYLVPIIAPSDDARRLTVT
SLQESGLKVNQPASFAIRLNGAKGKIDAKVPTPSGAVEECHVSELEPDKYAVRFIPHENG
IHSIDVKFNGSTWWAAPSRCVLVTGQAGNPTLVTAYGPGLESGTTGLQSEFFINTTKAGP
GTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIVAALQGKGYRKR
LVTLGSANETSSIMVESVTRSSTETCYSAIPKSTSDASKVVSRGAGLSKAFVGQKRLLLC
GLQKAGSNMLLVGVHGPTIPCEEVSIKHLGNHQYNVCGEGEGHYVWR
NT seq 7704 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcaggcgcggggccagggcggggccagagcggccgatcccgacggcgagatg
ccggccaccgagaaggacctggcggaggacgcgccctggaagcggatccagcagaacacc
ttcacccgttggtgcaatgagcacctgcgctgcgtcaacaagcgcatcggcaacctgcag
cacgacctgagcgacgggctgcggctgatcgcgctgctcgaggtactcagccagaagcgc
atgtaccgcaagtaccaccagcggcccaccttccgccagatgcagctggagaacgtctcc
gtcgccctcgagttctggagcgggagagcatcaagctggctctccatcgatagcaaagcc
atagttgatggaaacttgaagttgatccttggtctgatatggacccttatcctccactac
ttgatttccatgcctgtgtgggaggatgaaggtgacgatgatgcaaagaagcagactccc
aagcaaaggctgctgggctggattcagaacaagatcccttacctgcccatcacaaacttc
aatcaaaactggcaggatggcaaagcactcggggctctcgttgacagctgtgctccaggc
ctgtgccctgactgggagacctgggacccaagcaagcctgttgacaacgctcgcgaggcc
atgcagcaggcggatgactggttgggtgtgccgcagttattacctcctgaggaaattatc
caccctgatgtggatgaacactctgtaatgacttacctgtacacgttccctaaagccaag
ctgaagccaggagctcctttaaaacccaaactgaatccaaagaaagcaagagcttatggc
agaggaattgagcctcatgggaacatggtgaagcagcctgccatcttcacggtagacacc
atcagtgctgggcagggagacctgatggtctttgtagaggatccagaaggaaacagggaa
gaggcgaagataatgccatccagtgacaaaaacaagacctattctgttcagtatgtgcca
aaggttactggacctcacaaggtttcggttctatttgctggacaacacatctcaaagagc
ccttttgaagtgaacgttgacaaagcccagggagatgcaagcaaagtaacagcaaaggga
ccaggactggaggcaacaggaaacattgccaacaagcctacctactttgacctgtacaca
gcaggtgctggcgtgggtgacgtgatcgtggaagtggaagatcctcagggaagatgcctt
gctgaagttgcagtagaagacaaaggcaaccaagtctatcgttgtgtctacaaacctgtc
caagccggtcctcacgttgtcaaagtgacttttgcgggggaggcaattcccaaaactcct
tgcagtgttctcattggagaggcctgcaatccgaatgcttgtcgtgccaccggtagaggc
ctgcagcccaaaggcgtccgcatcagagaaacagcgactcagttgatacgagagcagcag
gcagtggagaccttgggtactatcaagacaaggctggaggagcttgtgaaacagaaaggc
tttatggatggtgtatatgcgtttgaatattatccagctaccccagggaaatacgttgtc
acgattacgtgggggggacacaacatcccaaaaagcccctttgaagtgcacataggtcat
gaagcaggccctcagaaagtacgagcctgggggccaggtctgcacgaagggattgtgggc
aggtcggctgacttcgtggtggagtccattggcacagaagttggttctcttggctttgcg
atagaaggtccttctcaggctaaaatagaatgtgatgacaagaacgatggctcatgcgat
gtgaagtattggcccaaagagcctggtgaatacgctgtgcacatcatgtgtgatgatgaa
gacatcaaggacagcccttacatggccttcatccgaccagcatcgggagacttcaacccg
gataaggtgagggcttacggtccaggcttggagagaagcggctgcatagtgaacaatcct
gctgagttcacagttgaaaccaaggatgctgggaaagcacctctgaaaatatattcacag
gatggagaaggaaaccctattgatatccagatgaagagcaagcctgatggtgtgtttgcc
tgttcctatgtgccagttaaaccaatcaaacataccatttctatagtctggggaggagcc
aacgtgcccagtagcccatttagggtcctgataggtcaggggagccatcctcagaaagtg
aaggtgtttgggcctggcgtggagagaactggcctgaaagcgagcgagccaactcacttc
actgttgactgcacagatgctggagaaggtgatgtcagcgttggaattaaatgtgatgct
cgtgtggtcagcgatgaggaggaagacatagattttgacattatccacaatgctaacgat
acgttcacagtgaagtatgcaccacctgctgccgggcgctacactattaaagtgcttttt
gcaggagaggaaattcctgccagtcctttcagagttaaagtggacccctctcatgatgcc
agcaaagtgaaagttaagttacctgggctgagtcaaaactggtgtggaaaatgcaagcca
acacacttcactgtgttcaccaagggagctgggaaggctccgctggatgtgcagttcagc
agtcctgtgccaggagaggtggtaacagatgtggacatcattgacaacatcgactattcc
cacactgtccggtacactccaatacagcagggaccgatgaaggttttggtaacgtacggt
ggagatcctatccctaaaagccctttcactgtgggagttgctgctccgctagacttgagc
aaagttaaagtcaatgggcttgaaaacagagtggaagtagggaaggatcaggaatttgta
attgacaccagaggagctggtggacaaggtaaactggatgttaatatttccagtcctatg
aggaaagctgtgccatgtctggtggagccagttctgggtaaggagtgcagtacagcaaaa
tacatcccaagggaggaaggattgtacgtggtggatgtgagctacgatggcaatccaatc
caggcagccctatactgtggagccactctgcctcctgatccctccaaggtaaaagctcac
gggccaggtctttcgaggaggcctcgttggaaaaccagctcaattcacaatatagatacc
aaaggggcaggaactggaggtttgggtttgacggtggagggcccatgtgaagctaagatt
gaatgctcggacaacggtgatggaacctgctctgtatcctatctgcctaccaagcctgga
gagtactttgtaaacatcctctttgaagaggttcacattcctggttcaccattcaaagca
gacatagaaatgccatttgacgtctctaaagtcattgccacaggaccaggtcttgaacgt
ggcaaagtaggtgaggcagggctgctgaatgttgactgtacggaagcgggtcctggtaac
ctgcgggtagacatggtgtcggatactgtttccaaagctgagatccagattgatgataac
aaggatgggacctatgttgtgacatatgtgccgctctcggctggcatgtacacaatcaag
atgaaatatggaggagagcaagtgcctaaattccctgcccgggtcaaagtggagccagct
gtggacacaagcagagttaaagtgtttgggccaggagtggaagggaaagatgtcttccga
gaagctacaacggatttcactgtggatgcccgacctctaacgaaagctggtggtgaccac
atcaggacacagatcacaagcccgtccggctcccccacagactgtcagatccaggacaat
gctgatgggacatacgcagtggagtacacaccatttgaaaagggtccacacacagtcaat
gtaacatatgatggcgtgcctgtgccaaacagtcccttcagagtgaatgtgacggagggc
tgccatccatcacgtgtgaaggcacaaggacctggactcaaagaagctttcacaaatcag
ccaaatgccttttcggttgtcaccagaggggcaggaattggtggccctggaataactgtt
gagggaccttcagagtctaaaatcagctgtaaagacaacaaggatgggagctgcagtgct
gagtacgttccttatgttccaggagactacgatgtcaatattacatatgggggagagcat
attcctggcagccctttcaaggttcctgtgaaggatgttgtggatcccagcaaggtgaag
attgcaggaccaggcctgggaacagctgttcgagccaaagtcccgcagtcctttactgtg
gacaccagcaaggcaggagtggcacccctggaggtggtggtggcaggacccagaggaatt
gtggagcctgttaatgtagtagacaatggagatggcacccacacagtgtgtacaccccta
cacaggagggaccatactgatctctgtcaaatatcagacgaagagattcctcgcagtccc
ttcaaggtgaaggtgcttcctacatatgatgccagtaaagtgacagcgagtggaccagga
ctcagttcctatggcataccagccagcctgcctgtggagtttgctgtggatgccaaagat
gccgggcagggacttctcactgtgcagataactgaccaagagggcaagcccaagagagtg
gacattcacgacaacaaggatggcacatacacagtgacctatgtccctgacaaaacgggc
cgctatacaattggtgtgaagtacggtggggatgacatccatcctctccctaccgaatcg
gcatctccagcgggggatgcagcacagtgtttggccacaggtcttggaattgcgcccacg
gtgaggactggtgaggaggttggttttgtggtagacgccaaatcagcagggaagggaaaa
gtgacgtgcactgtccttacgccagatgggacagaagctgaggcagatgttgttgaaaac
gaggacgggacttacgatatcttctacactgctgccaagccaggaacctacgtgatttac
gtccgcttcggtggggtggacattcccaacagccctttcactgtgatggtcacagaagag
gcttacgtaccggttggcgacatgaacggcatgggattccgtcccttcgatatggttatc
ccctttgctgtaaggaaaggagaaataacaggtgaagtacacatgccctctggaaagact
gatacaccagacattgtggataacaaggatggcactgtaacagtgagatatgctcctaca
gaagtgggcctgcatgagatgcacataaaatacatgggaaatcacatcccagagagccct
ctacagttctatgtgaattatccaaacagcggcagtgtgtctgcttacgggcctggcctc
atttatggggttgccaataaaccagcaacctttaccattgtcacagaagatgcagaggaa
ggtggactggacttggctattgaaggaccttccaaagcagagatcagctgcatcgataac
aaagacggcacatgcacagtcacctacctgcctactctacctgggaactacagcatactg
gtcaagtacaacgacaagcacatcccaggcagtccattcacagccaagattacagatgat
aacagaagacggtcccaagttaagcttggatctgctgctgagtttttgttggatatcaac
gagactgatctcagtctcctgacagctagcattaaggccccatcaggtcgtgatgagcct
tgtcttctgaagaggctgcccaacaaccacattggtatctcattcattccacgggaagta
ggagaacatctggttagcatcaagaaaaatgggaaccacgtaccaaacagccctgtgaca
atcatggtggtccagtctgagataggagtagccagacgagcaagagtttatggacgtggt
ttggtagaagggcgaacctttgaaatgtgtgacttcattgtagacacaagagatgcaggt
tatggtgggatctcactggcagttgaaggacccagcaaggtagatatccaaactgaagac
ctagaagatggaacttgcaaagtatcttattttccaactgtacctggcgtgtacattgtg
tccactaaatttgcagatgaacatattccaggcagcccatttactgtgaagataagtggt
gagggaagagttaaggagagcatcacacgaacaagacgggctccctctgttgcaacagtt
ggaagcatatgtgatctaaacctaaaaatcccacaaattgactgtggggacatgacggcc
caggtaactagtccctctggaagaaactccgatgcagaaatagtagaagttgacaaaaac
acctactgtgtccgctttgtgcctcaagaaatgggggtcacacggtggatgtcaaataca
gagggacctgtgccaggcagccccttccagttcaccgtggggccgctcggcgagggagga
gcccataaagtgagagctggagcccagggcggagcgtggagagagggtgtcccagctgag
ttcagcatatggacacgggaggctggagctggaggactgtccattgctgtagaaggtcca
agtaaagcagaaattgcctttgaagaccataaagatggatcttgtggtgtatcttacata
gttcaagagccaggcaactatgaggtgtccataaagttcaatgatgagcacattcctgaa
agcccctacctggttcccatcatcgccccgtctgatgatgctcgcaggctgactgtcact
agccttcaggagtctggattaaaagttaatcagccggcatcctttgctataaggctgaac
ggggcaaagggcaagattgatgctaaagtcccaacgccctccggagctgtagaagagtgc
catgtgtctgagctggagccagacaaatacgccgttcggtttatcccccacgaaaatggc
atccactccatcgatgtgaagttcaacgggagcacgtggtgggcagccccttcaaggtgc
gtgttggtgaccggccaggcgggcaaccccacactcgtcacggcgtatggaccaggcctg
gagagcggcaccacggggttgcagtcggagtttttcattaacacgaccaaggctggtcca
ggtaccctctctgttacaattgaagggccatcaaaggtgaaaatggactgccaggaaact
ccagaaggttacaaagtcatgtacacacccatggctccaggaaactatttaattggagtt
aaatatggtggacctaaccacatagtggcagcccttcaaggcaaaggttacaggaagcga
ctggtcaccctgggcagcgcaaacgaaacctcttccatcatggtagagtcggtgacaagg
tcgtcgaccgaaacgtgctatagcgccattcccaaatccacctcagatgccagcaaagtg
gtttcccggggagcaggactctcaaaggcttttgtgggtcagaaaagactccttctctgt
ggactgcagaaagcaggttcaaatatgctgttagtcggcgtccatggacccacaatcccg
tgtgaagaggtatccatcaagcatctgggcaaccaccagtacaacgtatgtggtgaagga
gaggggcactacgtctggcggtga

DBGET integrated database retrieval system