KEGG   Gallus gallus (chicken): 378922Help
Entry
378922            CDS       T01006                                 

Gene name
BUB1B, BUBR1
Definition
(RefSeq) BUB1 mitotic checkpoint serine/threonine kinase B
  KO
K06637  
mitotic checkpoint serine/threonine-protein kinase BUB1 beta [EC:2.7.11.1]
Organism
gga  Gallus gallus (chicken)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    378922 (BUB1B)
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     378922 (BUB1B)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: Other group
  BUB family
   378922 (BUB1B)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     378922 (BUB1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
5
AA seq 1086 aa AA seqDB search
MSRDGDDEWELSKENVQPLRQGRVMATLQEALAQQDTSSHTAAQLRKQEFESEIRFYSGD
DPLDVWDRYIKWTEQTFPQGGKESNLSAVLERAVKALNKQQRYYQDPRYLSLWLKFGNCC
NEPLDLYSYLHSQEIGTTLAQLYITWAEELEARGSFKKADIIFQEGLNRKAEPLDKLQSH
HRQFQTRVSRQTLLGLEEAADEKDTGLLETEEPQRSTLADLKGRGKKKVRAPISRVGDAL
KATNQNRNFQTPQQFSNNLGFAVFDENSASASGPEIPILTPQHWTEPPAPRGKENELSAG
PWNSGRRPRNSANSGVEVPCPMPSFTPYVEESAQQQVMTPCKIEPSINHVLSARKPEKEE
DPLRRVQNHHQDTQEKKEVVMYCKDKVYAGVEEFSFEEIRAEVYRKKAKKKAEEEIQTIA
QKKEEIQKKIEELEKKLKEKENHKQQQLHEQPTEVTKPSPPLGLKERTLSSATELGMKQP
HLQSECCLSEDIQLHKLSCSEDTEGGSVFSDSEDEQADQRNKANLGKKDAVFLPPPDPAT
SFSIFDESSTSANQNTSRSTDRGQKTARRPLAVRKPSESITAKENLQPEACDELHGIEPL
TEDAIVTGSYKHKSLCANPEDTCDFVRAAHLASTPFHGVVAQRIPAPAYSQSVLKEDCAE
SKSAPLDEKTPVCEGTYSEALCVNKLSPIMEASLEDTHLSGSSVSSGSSLSSVTQTSTIK
YLHIPEKLELAQSLPAEPITDPGGDDATEFLWTAEQRKKLLDPMPESLTASPHFHLEAGF
LPVIEFEKDIELGNETYCIKREYWTNEEYKMLFAIPVNFLQLDAKGFAIKVYSQPVPWDF
YIMLQLQERLNADFDQSFSGNCSCFLYQDGCAILHKNINRFTLGDVICGCKSIEEEVILL
VVYNLLGVVEKLHKAEIVHGDLRPEIFFLGDRICDPFANNGMTRALKIVDFSHSLDLRLQ
SRVSLPNSFPISQTPHGQQLLAKSCLPYQADLVGIADIAHLMLFGEHVQVYQENSVWKIS
QNVSKTVGSDFWGKFFRQILNADGKSTVLLLRELREEMSDMFDSCFQERLCESLVALGDV
FFLEKF
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgggacggtgacgatgagtgggagctgagcaaggagaacgtgcagccgctgcgg
cagggccgggtcatggccacactgcaggaggccctggctcagcaggacacctccagccac
actgccgctcagctgagaaaacaagaattcgaatcagaaatcagattttattctggagat
gatccactggatgtctgggacaggtacatcaagtggaccgagcaaaccttcccccagggt
ggaaaggagagtaatctctctgcagtattggaaagggcagtgaaagcactcaacaagcag
cagagatactaccaagatccccgctatcttagtctctggctcaaatttggaaattgctgt
aatgaacccttggatctgtacagttatctgcatagtcaggaaattggtacaacgctggca
caactctatattacatgggcagaagaacttgaggctagaggaagttttaagaaagcagat
ataatcttccaggaaggccttaatcgcaaggcagagcctttggacaaactccagtctcat
cacaggcagtttcagacccgtgtttctcggcaaacactactgggacttgaggaagctgct
gatgaaaaagatacgggtcttctggaaactgaagaacctcagaggagcacattggcagat
ctaaaaggcaggggaaagaaaaaagtgagagctccaattagtcgtgtaggagatgcactt
aaagccacaaaccaaaacagaaacttccagactcctcagcagttttcaaacaatctgggt
tttgctgtgtttgatgaaaattccgcttcagcttctggacctgagattcccatacttact
ccacagcactggacagaacctccagctccaaggggcaaggagaatgaactaagcgcagga
ccttggaactctgggaggcgtcctcgcaacagtgcaaattctggtgtagaagtgccctgt
ccaatgcccagtttcaccccctacgtggaagagtcagctcagcagcaagtcatgactccc
tgcaagattgaacccagcataaaccacgttttaagcgctcgcaagcctgagaaggaggag
gatcctctacgacgggtccagaatcaccatcaggatacccaggagaagaaagaggtggtg
atgtactgtaaagacaaagtttatgctggagtggaggaattctctttcgaagagattcga
gctgaagtctacagaaagaaagcaaaaaagaaagctgaagaggagatacagaccatagca
cagaaaaaggaagaaatacaaaagaaaattgaggaactggagaagaaattaaaggagaaa
gaaaaccacaagcaacaacaattacatgagcagccaacagaggtaacaaagccttcacca
cctttgggactaaaagaacgtactttatccagtgcaacagaacttgggatgaaacagcct
cacttgcaaagtgaatgctgcctctcagaagatattcaactgcataaactgtcttgttct
gaggatacggaaggaggaagtgtattttctgactctgaggatgaacaggcagatcagaga
aataaagccaaccttggaaaaaaagatgcagtattccttcccccaccagatcctgctaca
tctttctccatatttgatgaatcatctacttcagcaaaccaaaatacaagtcgttctaca
gatcgtggccagaaaactgctcggcgccctcttgctgttcgcaaaccttcagagtctatc
actgcgaaagaaaacttacaaccagaggcctgtgatgagctgcatggaattgaacctttg
actgaagatgccattgtgacaggctcctacaagcacaaaagcctttgtgccaacccagaa
gacacgtgtgattttgttagggctgcccatctggcctcaactccctttcatggggtggta
gctcagagaatcccagctcctgcttattcacagagtgttctaaaggaagactgtgcagaa
tctaagagtgcacctctggatgagaaaacaccagtttgcgagggaacatacagtgaagct
ctctgtgtaaataaattgagcccgatcatggaagcaagcctggaggatactcatttgtca
ggttcttctgtctcttcaggatcttctctttcttctgttacacaaacatccacaattaaa
tacctgcacatccctgagaaactggaacttgctcagagcttgcctgctgaaccaattact
gatcctggaggtgatgatgcaactgagttcttgtggactgctgaacagcgtaaaaagctt
ctagatcccatgccagagtcattgactgcttctccacattttcatttggaggctggtttc
ctgcctgtcattgagtttgagaaagacattgagctaggaaatgagacttattgtatcaaa
cgggaatattggaccaatgaagaatacaaaatgctttttgccattcctgttaactttctt
cagttggatgcaaagggatttgcaataaaggtgtattctcagcctgtgccttgggatttt
tatatcatgcttcaactgcaggagcgtttgaatgctgactttgaccaaagcttcagtggg
aactgtagctgtttcttgtaccaagacggctgtgctatcctgcacaagaatataaatcgc
ttcacgcttggggatgttatttgtggctgcaagtccattgaagaggaagttattctacta
gttgtttataatcttctgggtgtggtagagaagctccacaaagcagagattgtccatgga
gatctgaggccagaaatattctttctgggagacaggatctgtgatccatttgctaataat
gggatgacaagagctctgaagatagtggatttctctcacagtctggatttaaggttgcag
tctcgagtaagcttgcccaacagctttccaatatctcagactcctcatggacagcagctt
ctggcaaaaagttgccttccttatcaggcagacttggttggtatagcagatatagcccat
ttgatgctgtttggtgagcatgtccaggtctatcaggagaactccgtttggaaaatcagc
caaaatgtatccaagactgttggctctgatttctggggtaaatttttccggcaaattctg
aatgcagatggtaagtccacagtgcttctgctgagggagttgagagaggaaatgagtgac
atgtttgacagctgtttccaagaacgtctttgtgaatccttagtagcgctgggtgatgtt
ttcttcttggagaagttctga

DBGET integrated database retrieval system