KEGG   Gallus gallus (chicken): 395099Help
Entry
395099            CDS       T01006                                 

Gene name
CREB1
Definition
cAMP responsive element binding protein 1
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
gga  Gallus gallus (chicken)
Pathway
Adrenergic signaling in cardiomyocytes
Melanogenesis
Class
Organismal Systems; Endocrine system; Melanogenesis [PATH:gga04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:gga04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
7
AA seq 327 aa AA seqDB search
MTMESGAENQQSGDAAVTEAETQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETAAPAIATVTVPTPIYQTSSGQYIAITQGGAIQLS
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagccgttacagaggca
gaaacccaacagatgacagtacaggcacaaccacagattgcaacgttagcccaggtatct
atgccagcagctcacgccacgtcttctgcacccacggtgaccttagttcagctgcccaat
gggcagacagttcaagtgcacggcgtaattcaggctgcccagccatcagttattcagtct
ccacaggtccagacagttcagatttcaactatagcagaaagtgaagactcacaggaatca
gtggacagtgtcacagattcacagaaacggagagaaattctttccagacgaccctcctac
agaaaaattttgaatgacttgtcctcagacgccccaggagtgccaaggatcgaagaggaa
aagtctgaagaggaaacagcagcacctgccattgccactgttacggtgccaactcccatt
taccaaaccagcagtgggcagtacattgctattacgcaaggaggagcaattcagttgtct
aacaacggcacggatggagtacaaggtctccagacgttgactatgaccaatgcagctgca
acacaacctggcactaccattttacaatatgcacagaccacagatggacaacagatactt
gtacccagcaaccaagttgtagtacaagctgcctcaggagatgtacagacctaccagatt
cgcaccgcccctaccagcaccattgcacctggagtagtcatggcatcatctccagcactt
ccaacccagccagcagaagaggccgcacggaagagagaagtgcgtctaatgaagaacaga
gaggcagcacgtgaatgtcgcaggaagaaaaaggagtatgtgaaatgtctagaaaatcga
gtggctgtgcttgaaaaccaaaacaagacactgattgaggagttgaaagcacttaaagac
ctttactgccacaaatcagattaa

DBGET integrated database retrieval system