KEGG   Gallus gallus (chicken): 395136Help
Entry
395136            CDS       T01006                                 

Gene name
PCSK2, PC2
Definition
proprotein convertase subtilisin/kexin type 2
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     395136 (PCSK2)
Peptidases [BR:gga01002]
 Serine Peptidases
  Family S8: subtilisin family
   395136 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
3
AA seq 644 aa AA seqDB search
MPAGPPPLLLRGAFVLLLLVLLLLSLGAPARAAVYTNQFLVELHSGDQAEAERVAADHGF
GGVRKLPFLDTGYYFYHNGIAKVRRRRSFQHKLHLEKDSRVKKAVQQEGFSRRKRGYRDI
NDIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLH
PDLASNYNAQASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSK
VAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDNGKTVDGPRELTLQAMADGVN
KGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLAST
FSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTV
LTSKRNQLHDEVHRWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSIQ
EPEKIPPSGKLVLTLTTDACEGKENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSI
LLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEIGFVGGVPQRGVLKEWTLMLHGT
QSAPYIDQIVKDYQSKLAMSKKEELEEELDEAVERSLKSILSKN
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgccggcggggccgccgccgctgctgctgcgaggcgccttcgtcctcctcctccttgtc
ctcctgctgctctccctcggcgccccggcccgggcagccgtctacaccaaccagttcttg
gtggagctgcacagcggggaccaggcggaggccgagcgggtggcggcggatcacggtttc
ggaggggtgcgcaagctcccttttctagatactggttactacttctatcacaatggcatt
gccaaggtcagaagaagacgaagttttcaacataagcttcatctggaaaaggattccagg
gtcaagaaggctgtgcagcaggaaggttttagcagaagaaaacgaggatatagagacatc
aatgacattgacatcaacatgaatgatcctttatttacaaagcagtggtacttgattaac
actggtcaagcagatgggacacctggacttgatcttaacgtagctgaggcgtgggagctg
ggatacacagggaaaggagttaccataggaattatggatgatggaattgattatctgcat
cctgatcttgcctccaattataatgcccaagctagctacgatttcagcagtaatgatccc
tacccctacccccgctatacagatgactggttcaacagccatgggacccgatgtgctgga
gaggtgtctgcagctgccaacaacaacatctgtggcgtgggagtcgcctacaactccaag
gtggcaggtattcggatgctcgaccagccatttatgacagacattattgaggcttcctct
atcagtcatatgcctcaggtcatagatatctacagtgccagctggggaccaactgataat
ggaaagactgtggatggacctagagagctaacactacaagcgatggcggacggagtgaac
aagggccggggagggaaaggaagcatctacgtctgggcttccggagatgggggcagctac
gatgactgcaactgtgatggttatgcatcaagtatgtggacaatttccatcaattctgca
ataaatgatggacggacagctctgtatgatgaaagctgctcttcaaccctagcctccaca
ttcagtaacgggaggaagagaaatccagaggctggtgtggctacaacagacttgtatggc
aactgcaccctgcgtcactcaggaacgtctgcagctgcccctgaagcagcaggagtgttc
gccttggccctagaggctaacttggatctaacctggagagacatgcagcatctgacagtt
ctcacctccaaaaggaaccaacttcatgacgaagttcatcggtggcgtaggaatggtgtt
gggctggaattcaatcatttatttggctatggtgtcctagatgcaggagcaatggttaag
atggcaaaagactggaagactgttcctgagagattccactgcgttggggggtcaatacag
gaacctgaaaagataccaccaagtggcaagctggtcctcacgcttacaactgatgcttgt
gaagggaaggagaattttgtacgttaccttgaacacgtccaagcagttataactgtgaat
tcaactcggcgaggagacctcaacatcaacatgacctcgccgatgggaaccaagtccatc
ctactgagccgacgtccaagggatgatgattccaaggtgggttttgacaaatggcctttc
atgaccacacacacttggggagaagacccccgaggcacctgggttctagagattgggttt
gttggcggtgtgccgcagcggggtgtgttgaaggagtggacactgatgctgcatgggacc
cagagtgcaccatacatagaccaaatagtaaaagattatcagtccaaactggccatgtcc
aagaaggaagagctggaagaagaattagatgaagcagtggagagaagcctgaagagtata
ctgagcaagaactag

DBGET integrated database retrieval system