KEGG   Gallus gallus (chicken): 395138Help
Entry
395138            CDS       T01006                                 

Gene name
ST3GAL6, ST3GAL-VI
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 6 (EC:2.4.99.-)
Orthology
K03792  
beta-galactoside alpha-2,3-sialyltransferase (sialyltransferase 10) [EC:2.4.99.10]
Organism
gga  Gallus gallus (chicken)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:gga00601]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 352 aa AA seqDB search
MKRILLFFILAAAVMYGILHGNLWRNNFYWISFYGQTSSVRGPSSSEASGVTQLPPTAVE
RRNALNTCTLKPAFESLLDVEKIYPFLCASDFIRVAEYHGSDKFELPYGIKRAEQFFRSA
LSKLQNCGLSNKDDSVACRRCVVVGNGGVLRNKTLGGKIDSYDVIIRMNNGPVIGYEEDV
GRRTTFRLSYPESIFSDPIHYDPNTTVVIIVFKPRDLKWLWEILGGQKISAKGFWKKPAL
NMIYKSNQIRILDPSITRKTAYDWLHFPTRFPKKEKPKHPTTGLIAITLAFHICHEVHLA
GFKYDFTDRNSSLHYYGNETMSQMMQNEYHDISAEQKFLKKLIDKNFVVNLT
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattcttctgtttttcatcctggctgctgctgttatgtacggtatattgcat
ggaaatctgtggagaaataacttctactggattagcttttatggacagacttcttctgtg
aggggtccttcttccagtgaggctagtggagttacccagctgccacctacggctgtggag
agaaggaacgccctaaacacttgcactctgaaaccagcatttgaatctttactggatgtt
gagaaaatatacccgttcctgtgtgccagtgattttatcagagtggcagagtaccatgga
agtgataagttcgagctaccttatggaataaagagagcagaacaattttttcgttcagcc
ctttcaaaactgcaaaattgtggactgtccaacaaagacgacagtgttgcctgccgacgg
tgtgttgtggtcggtaatggaggagtacttcgaaataagacgttaggagggaaaattgac
tcctatgatgtgataataagaatgaataatggccctgttatagggtacgaagaggatgtt
gggagaaggacgactttccgcctttcctacccagaatccatcttctcagatccaatccac
tacgaccctaacactactgttgttattatcgtcttcaaaccacgtgacttaaagtggctt
tgggagattttaggtggtcagaaaataagtgctaaaggcttttggaagaaaccagctcta
aacatgatatataaatctaatcaaatcaggattcttgatcccagcatcaccagaaaaaca
gcttatgattggcttcatttcccaacaagatttcccaaaaaagagaaacccaagcatcca
acaacggggctaattgccattacactagcatttcacatttgtcatgaagttcacctggcg
ggcttcaaatatgacttcactgacaggaacagttctttgcactactatggcaacgaaaca
atgtctcagatgatgcagaatgaataccatgacatcagtgctgagcagaaattcttgaag
aagcttatagacaagaactttgtggtcaacttgacgtga

DBGET integrated database retrieval system