KEGG   Gallus gallus (chicken): 395177Help
Entry
395177            CDS       T01006                                 

Gene name
BMP10, BMP-10
Definition
(RefSeq) bone morphogenetic protein 10
  KO
K05503  
bone morphogenetic protein 9/10
Organism
gga  Gallus gallus (chicken)
Brite
Cytokines [BR:gga04052]
 TGF-beta family
  Distant members
   395177 (BMP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
22
AA seq 425 aa AA seqDB search
MDSIVLQLWAGLCLLVHLATCSPILSLEHSSLEEGEPLFDEFLSEQDGVDFNTLLQNMKN
EFLKTLNLSDIPLHESAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLASHPVGV
IGVRKYPLLFNVSIPHHEEITMAELRLYTLVERDQMLYEGLDRKVTIFEVLENDHMGVGE
ERKIVALASRQIYGTSSEWESFEVTEAIRRWRRAGLTTHRLEVHIESREGEEQNGEGKLD
IDINSEAKHVPLLIVFSDDQSNDQKEEKQELNEMIDHEQLLDLENLEVGNFHGHPGEEAL
LQMRSNIIYDSTARIRRNAKGNYCKKTPLYIDFKEIGWDSWIIAPAGYEAYECHGVCAYP
LTEHVTPTKHAIVQTLVHLKNPQKASKACCVPTKLDPISILYMDAGVVTYKFKYEGMVVS
ECGCR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggattccatagtcctccagctgtgggctggcctctgcctcttggttcaccttgccact
tgcagtcccatcctgagcttggagcactcttccttagaggaaggcgagcctcttttcgat
gaattcctgtccgagcaggatggtgttgatttcaacacattgcttcagaatatgaagaac
gagttcctgaagacgttgaacctctccgacattcctctgcacgagtcggccaaagtggac
ccaccagagtacatgttagagctgtacaacaagtttgccactgacaggacatctatgcca
tctgcaaatatcattaggagcttcaaaaatgaagaccttgcttcccaccctgttggcgtc
ataggagttcggaaatacccccttctgttcaatgtctccatccctcatcatgaagaaatc
accatggcggagctgagactctacaccttggtggagagggaccaaatgctttatgaaggg
ctcgaccgaaaggtcaccatttttgaagtgctggaaaatgaccatatgggggtaggagaa
gaaagaaagatcgtggcgctggcatccagacagatctatggcacaagcagtgagtgggag
agcttcgaggtgaccgaagccatcaggcgttggcgaagggcagggctgaccacgcaccgg
ctggaggttcacattgagagcagagaaggggaggagcagaatggagaggggaaactcgat
atcgacatcaactctgaggctaagcacgtgcccctgttgattgtgttctctgatgaccaa
agcaatgatcagaaagaggagaagcaagagctgaacgaaatgatagaccatgagcagctc
ctggacttggagaacctggaagttggcaatttccatggacaccctggtgaggaggctctg
ctccagatgcgttctaacatcatttatgactctactgctcgaatccgaaggaacgcaaaa
ggcaactactgcaaaaagactccactctacatagatttcaaggagattggctgggattcc
tggatcatcgctccagcaggatatgaagcttatgagtgccatggagtatgcgcctacccc
ttaacagagcacgtcaccccaacaaaacatgccattgtccagactttggttcacttgaag
aatccccagaaagcctccaaggcctgctgcgtgcccaccaaactcgatcctatctcaatt
ctctacatggatgcaggggtggtcacctacaagttcaaatatgaaggcatggtggtatca
gagtgtggctgcagatag

DBGET integrated database retrieval system