KEGG   Gallus gallus (chicken): 395233Help
Entry
395233            CDS       T01006                                 

Gene name
DYRK1A, MNB
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A (EC:2.7.1.-)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     395233 (DYRK1A)
Protein kinases [BR:gga01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   395233 (DYRK1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 756 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMSHSHQQYSDRRQQNINDQQVSASSYT
DRIQQPLTNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDDSS
HKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVAIK
IIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLNRHFMFRNHLCLVFEMLSYNLYDL
LRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDF
GSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANEVD
QMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGTRKLHNILG
VETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEGTN
TSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFTAAVQA
MDCETHSPQVRQQFPPPIGWTATEAPTQVTVENHPVQETTFHVTPQQQNALHHHHGNSSH
HHHHHHHHHHHHGQQALGSRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLASSTTSSST
SSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDMNLTVYSNPRQETGIAGHPTYQFSANTG
PAHYMTEGHLAMRQGIDREESPMTGVCVQQSPVASS
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgcatactgggggtgagacttcagcatgcaaaccttcatctgttcggcttgcaccatcg
ttttcattccatgctgctggccttcagatggctggacagatgtcccattcacatcagcag
tacagtgatcgtcggcagcagaacataaatgaccaacaggtttctgcctcatcatacact
gaccggattcagcaacctctaacaaaccagaggcggatgccccaaactttccgtgatcca
gctactgctcctttgaggaaactctccgtagatttgattaaaacatacaagcatattaat
gaggtttactatgctaaaaagaaacggcgacatcaacagggccaaggagatgattccagc
cacaaaaaggaacggaaagtttacaatgatggctatgatgatgacaactatgactatatt
gtaaaaaatggggagaagtggatggatcgttatgaaattgactctttaataggcaaagga
tcctttggacaggttgtaaaggcttatgatcgagtggaacaggagtgggtggctatcaaa
ataataaaaaacaagaaagctttcttaaaccaagcccagattgaagtgcgactgcttgag
cttatgaacaaacatgacactgagatgaagtactatatagtgcatttgaaccgccacttc
atgttccgaaaccatctctgcttagtcttcgaaatgctgtcctacaatctgtatgatttg
ttgcggaacaccaacttccgaggggtctctttgaatctgacaagaaaatttgcccagcag
atgtgcactgcactgctttttctggcgactcctgaacttagtatcattcactgtgaccta
aaacctgagaatatcctgctctgtaaccccaaacgaagcgccatcaagattgttgatttt
ggcagttcttgtcaacttgggcagaggatataccaatatatccagagtcgtttctatcga
tcaccagaggtgctactgggaatgccttatgatcttgcaattgatatgtggtcccttggg
tgtattttagttgagatgcacactggagagcctcttttcagtggggcaaatgaggtggat
caaatgaataaaatagtggaagttttggggataccgcctgcccatattcttgaccaagca
ccaaaagcaagaaagttctttgagaagttgccagatggcacttggaacttgaagaagacc
aaagatggaaaaagggaatacaaaccacctggaactcgtaaacttcacaatatactagga
gttgaaacaggaggaccaggtggacgtcgtgctggggaatcgggtcatactgtagctgac
tacttgaagttcaaagacctcatcttaaggatgcttgattatgaccctaagacacgaatt
caaccttattatgccctacagcatagtttctttaagaaaacagcagacgaaggtaccaac
acaagcaacagtgtgtctacgagtcctgccatggagcagtcacagtcttcaggaaccacc
tctagtacatcttcaagctcaggtggatcttctggaacaagcaacagcggaagggcacgg
tcagaccccacgcaccagcatcgacatagtggtggacacttcactgctgctgttcaagct
atggactgtgaaacacacagcccacaggttcgacaacagtttcctcctccgattggttgg
acagccactgaagctcctacacaggtcactgttgaaaaccatccagttcaagaaaccacc
ttccatgtaacccctcaacaacagaatgcattacatcatcatcacggaaatagctctcac
caccaccatcaccaccaccaccaccaccatcatcatggacagcaagccttgggtagccgg
accaggccaagggtctacaattctccaacaaacagctcctccacccaggattctatggag
gtgggccacagtcaccactccatgacatccctggcttcctcaactacttcttcctctaca
tcttcctcctctactggtaaccaaggcaatcaggcctatcagaaccgcccagtggctgct
aataccttggactttggacaaaatggagctatggacatgaatttaacagtctactctaat
ccgcgccaagaaactggcatagctggacatccaacgtaccagttttctgctaatacaggt
cctgctcattacatgactgaaggacaccttgcaatgaggcaagggattgatagagaagag
tctcccatgacaggagtttgtgttcagcaaagtcctgtggctagctcgtga

DBGET integrated database retrieval system