KEGG   Gallus gallus (chicken): 395260Help
Entry
395260            CDS       T01006                                 

Gene name
FLNC
Definition
filamin C, gamma
Orthology
K04437  
filamin
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    395260 (FLNC)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    395260 (FLNC)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    395260 (FLNC)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   395260 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
Un
AA seq 2658 aa AA seqDB search
MNSSGYEETAVPEDAEELPAAEKELAEDAPWKKIQQNTFTRWCNEHLKCVNKSISDLQRD
LGDGLRLIALLEVLSQKKMGRKHHPRPNFRQMKLENVSVALEFLERERIKLVFIDSKAIV
DGNLKLILGLVWTLILHYSISLPMWEEEEEGARQQTPKQRLLGWVQHRVPQLRITNFNRD
WNDGRALGALVDNCAPGLCPDWQSWDPAQPVQNAREAMQQADDWLGVPQVIAPEEIADPN
VDEHSVMTYLSQFPKAKLKPGAPLRPRAVRPERVRAYGPGLEPQGNVVLQPARFTVETWT
RARQVLENARDHRAHHEEAQVVANNDEKRTFSVTYVPKVAGLHKVTVLFGGQNIPGSPFV
GVAMAHGDASKVSARGPGIEPSGNVANKPTYFDIYTAGAGSGDVGVVLEDPAGPRDTVEG
DMEDRGDSTFRCSYRPTLPGPHRVAVTFAGAHIPNSTFCVNVAEACNPSACRAWGRGLQP
KGLRVHETADFRVHTNAPAELRVTVPDRGTEVPVSVRPTADGVYECEYRPTVAGTHSVSI
TWGGYSIPRSPLEVEVSPAAGAQKVRAWGPGLHGGVVGDSADFVVEAIGDDVRTLGFSIE
GPSQPKIESDDPGDGSCDVRYWPTEAGPYPVHVVCDDEDIARSPFMAHIRPAAPDCSPDK
VKVWGPGLEPTGVIVNRPTEFCVDARAAGKGGLHIYAQDADGCPVDIAVKDNGDGTFSCH
YVPSKAIKHTVIVTWGGVNVPRSPFRVAVGKGSHPGRVRVYGPGVERAGLTAGEPTYFTV
DCSDAGQGDVSIGIKCCPALPGAAEADIDFTIIKNDNDTFTVKYTPPCAGLLTVMVLFGT
QELPCSPFRITVAPAHDSSKVRAEGPGISRTGVESGRPTHFTVQTRGAGKAPLDVQFGGA
AQSGVSDVQIIDNGDYSHTVKYTAMRQGELSVGVTYGGDPIPKSPFPVTVAPPLQLDKVS
VQGLSSKVPVGAPQSFSVLSSGAGGQGALSVTAMGAGRRSVPVAVESAGPGLHRARFTAA
EEGQLRFDVTYDGHPVPGSPFVVDAVLPPDPSKVHAFGPGLHGGVAGSPATFTISTRGAG
SGALGLTVEGPREAELECHDNGDGSCSVRYVPPEPGDYSLNILFAGTHVPGSPFRAAVRP
RFDATKVRADGPGLRSGRVGQIATFAVDCRDAGEAELNIEIRHELGARPEVRIHDNGDGT
YGISYTPARAGAYTVTVSYGGVPVPHFPACVTVEPDVDLSAIAVYGTGVEPRGPLRDVST
EFTVDARAVVPSGGPHVGARVTAPSGATTDCSVSDGGDGTYRVRYTPREEGVHQVEVTFQ
EVALPQSPFAVAVAEGCDPTRVSAHGPGLESGLVGRANCFTVQTRGAGTGGLGLAIEGPS
EAKMSCQDNKDGSCSVEYVPFAAGDYDVNITFGGRPIPGSPFRVRVSEPVDASQVRCSGA
GLGPTVRARLPHSVNVDCSAAGRAALDVTLLGPTGTPEPVEVRDNGDGTHSVTYSPTAVG
PHSLSIAYGGQEVPRTFKLQAVPHDASRVLASGPGLSPSGVPASLPVEFAIDARRAGQGV
LTVQILDPEGRPTEASIEDHGDGTFTVRYLPRLVGRYSITVRYGGDDIPASPFCIHGAPS
GNASKCHVTGGCAFPTLRPGERTLLAVDARAAGPGKVTCSVLSPDGAEVDVDVAENPDGT
FHVSYTAPEPGSYGLTVRFGGQHVPNSPFRIVATAEPPRPRDLRPFSLDLPCAPLKGDIT
AEVRTPSGRTARAEVAQSGDGTVAVRFEPSEKGRHLMELRCDGDPLPGSPLQFYVDAVDA
RHVSAYGAGLSHGVVNKACSFTVITKGAGEGGLSLAVEGPSKAELSCHDNHDGTCTVSYV
PTAPGDYSVIVRFDDEHIPGSPFTAKITGDDSLRTSQLNVGTATDVSLKISETDLSQLTA
SIRAPSGSEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKGGQHVTNSPFKIVVGPSEIG
NAERVKVWGTGLSEGRTFQLAHFVVDTRSAGYGGLGLSVEGPSKVDIHCEDAEDGTCKVS
YCPTEPGSYRLSVKFAEQHVPGSPFTVKVSGEGRVKESITRARQAASIAAIGSACDLNLK
IPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETTREVRVQESTRVGAEPFH
GVFGGFLGGFGAAARGQEDAAPPELTAQVLSPSGQHSEAEVQAGPGSAYRVRFVPEELGP
HSVAVKFRGQHVPGSPFPFTVGPLGEGGAHRARAGGPGLQRGVAGVPAEFSIWTREAGAG
GLSIAVEGPSKAEINFEDRKDGSCGVTYLVQEPGDYEVSIKFNEEHIPDSPFVVPVASRS
DAAQHSTVSSAQEALRVNHPAALSVHLNGARRPFDAKVLSPTGTVSECSVSEIDPDLYSI
GFLPVENGVHAVEVRLNGRHVPGSPFNVRVGEQSHDADPGLVTAYGAGLQGGVTGVRSEF
VVKTANAGSGALSVTIDGPSKVTLDCVECAEGHRVTYTPMAPGNYLISIKYGGPHHIVGS
PFKAKVTGPRLSGGHSLHETSSVLVETVTRGALGPPGFGTLPKFSSDASKVVARGPGLST
AFVGQKNHFTVDCSKAGSNMLMVGVHGPKTPCEEVYVKHVGNRLYNVTYTVKEKGEYVLI
LRWGDDSVPGSPFRVTVP
NT seq 7977 nt NT seq  +upstreamnt  +downstreamnt
atgaactcttcgggctacgaggagacggcggtgccggaggacgccgaggagctgccggcg
gccgagaaggagctggcggaggacgcgccgtggaagaagatccagcagaacacgttcacg
aggtggtgcaacgagcacctgaagtgcgtcaacaagagcatctcggacctgcagagggac
ctgggggacgggctgaggctcatcgctctgctggaggtgctgagccagaagaagatgggg
aggaagcatcaccccaggcccaacttccggcagatgaagctggagaacgtgtcggtggcg
ttggagttcctggagagggagaggatcaagctggtgttcatcgacagcaaagccatcgtg
gacgggaacctgaagctgatcctgggcctggtgtggacgctgatcctacactactccatc
tcgctgcccatgtgggaggaggaagaggagggcgcccggcagcagaccccaaagcagcgc
cttttggggtgggtgcagcaccgggtcccgcagctccgcatcaccaacttcaaccgagac
tggaacgacggccgcgcgctgggggcgctggtggacaactgcgcgcctgggctgtgcccg
gactggcagagctgggaccccgcgcagccggtgcagaacgcgcgcgaggcgatgcagcag
gccgatgattggctcggagtgccgcaggtgatcgccccggaggagatcgcggaccccaac
gtggacgagcactccgtgatgacgtatctgtcgcagttccccaaagccaaactgaagccc
ggcgcccctctgcggccgcgcgcggtgcggcccgaacgcgtccgcgcatatgggcccggg
ctggagccgcaggggaacgtggtgctgcagccggcgcgcttcacggtggagacgtggacg
cgggcacggcaggtgttggagaacgccagagaccaccgagcacaccacgaggaggcccag
gtggtggccaacaacgatgagaagaggaccttctctgtcacctacgtccccaaagtggcg
gggctgcacaaggtgacggtgctgtttggggggcagaacatccccgggagcccctttgtg
ggggtggcgatggctcacggcgatgccagcaaagtgtctgcgcgcggccccggcatcgaa
cccagcggcaacgtggccaacaaacccacctacttcgacatctacaccgcaggtgcgggt
tcgggtgacgtcggggtggtgttggaggaccccgcgggaccgcgtgacaccgtggagggt
gacatggaggaccgcggggacagcaccttccgctgctcctatcggcccaccctgcccggc
ccccaccgcgtcgccgtcaccttcgccggagcccacatcccaaacagcaccttctgcgtc
aacgtggccgaagcgtgcaacccttcggcgtgccgtgcgtgggggcgggggctgcagccc
aaagggctgcgcgtgcacgagacggccgacttccgcgtgcacaccaacgcgccggcagaa
ctgcgcgtcaccgtgccggaccgaggcacagaggttccggtgtcggtgcgccccacggct
gatggcgtttatgagtgcgaataccgccccactgtggccgggacccacagcgtctccatc
acgtgggggggatacagcatcccgaggagccccctggaggtggaggtgtctccggccgcg
ggcgctcagaaggtccgtgcgtgggggccggggctgcacggcggcgtcgtgggcgactcg
gccgacttcgtggtggaggctatcggggacgacgtacggactctggggttctccattgag
ggtccgtctcagccaaagatcgaatccgacgacccgggcgacggttcgtgcgacgttcgc
tattggcccacggaggcggggccgtaccccgtgcacgtcgtgtgcgacgatgaggacatc
gcccgcagccccttcatggcccacatccgccccgccgcccccgactgcagccccgacaag
gtgaaggtttggggtcccggcctggagcccacgggggtcatcgtcaaccgccccactgag
ttctgtgtggacgcccgcgctgccggaaagggggggctgcacatctatgcacaggacgcc
gacggctgcccggtggacatcgcagtgaaggacaacggggacggcaccttcagctgccat
tacgtccccagcaaagccatcaaacacaccgtcatcgtcacctgggggggggtcaacgtc
ccacgcagccccttccgggtggcggtggggaagggcagccatccgggccgcgtccgcgtc
tacgggccgggggtggagcgcgccgggctgacggcgggggagcccacctacttcaccgtg
gactgcagcgacgccgggcagggcgatgtcagcatcggcattaagtgctgcccggcgctg
cccggcgcggcggaggcggacatcgatttcaccatcataaagaacgacaacgatacgttc
accgtgaaatacaccccgccgtgcgccgggctgctcaccgtcatggtgctcttcgggacg
caggagctgccctgcagtccgttccgcatcacggtggccccggcccacgacagcagcaaa
gtgagagcagagggacccgggatcagccgcaccggcgtggagtcggggcgccccacgcac
ttcacggtgcagacgcggggggcggggaaggcccccctggacgtgcagtttgggggcgcg
gcgcagagcggcgtcagcgacgtgcagatcatcgacaacggcgactacagccacaccgtc
aaatacaccgccatgcggcagggggagctgtctgtgggggtgacttatgggggggatccg
atccccaaaagcccctttcccgtcaccgtggcgccgcctctgcagttggacaaagtgtcg
gtgcagggactgagcagcaaggttccggtgggcgccccgcagtcgttctcggtgctgagt
tccggcgccggcgggcagggggcgctgtcggtgacggcgatgggcgcggggcggcgctct
gttccggtggcggtggagtcggccgggccggggctgcaccgcgcgcggttcacggcggcc
gaagagggacagctccgcttcgacgtgacgtacgacggacaccccgtgccgggcagcccc
ttcgtggtggacgcggtgctgccccccgacccctccaaggtgcacgccttcggtccgggc
cttcacggcggcgtagcgggcagcccggccacgttcaccatctcgacccgcggcgccggt
tcgggcgcattgggtctgacggtggaaggaccccgagaggcggagctcgaatgccacgac
aacggagacggttcgtgttcggttcgctacgtaccgccggaaccgggcgattacagcctc
aacatcctcttcgccggtacccacgtgccgggatcgccgttccgagcggcggtccgaccc
cgtttcgacgccaccaaagtccgggcggacggccccggtttaaggagcggccgcgtgggt
cagatcgccactttcgccgtggattgccgcgacgcgggggaggcggagctcaacatcgag
atccgccacgagctcggagcgcggcccgaggtccgcatccacgacaacggcgacgggacg
tacggcatctcctacaccccggcccgggccggcgcctacaccgtcaccgtcagctacgga
ggagtgcccgtcccgcacttccccgcctgcgtcaccgtggagcccgacgtggatctcagc
gccattgcggtgtatggcaccggcgtggagcccaggggccctctccgtgacgtcagcacg
gagttcacggtggacgcgcgcgcggtggtcccttcgggcggtccccacgtgggggcgcgc
gtcaccgccccgtccggagccaccaccgactgcagcgtcagcgacggcggcgacgggacg
taccgcgtccggtacacgcccagagaggagggcgtgcaccaggtggaggtgacgttccag
gaggtggcgctgccgcagagccccttcgctgtggccgtggccgaaggctgcgaccccacg
cgtgtgagcgcccacgggcccggcctggagagcggcctggtgggcagagccaactgcttc
accgtgcaaacgcggggcgccgggacggggggtttggggttggccatcgagggtccttcg
gaggccaagatgtcgtgccaggacaacaaagatggcagctgctccgtggaatacgtcccc
ttcgcggccggggattacgatgtcaacatcaccttcggggggcggcccatccccggctct
ccgttccgcgtgcgcgtttcggagccggtggacgcgtctcaggtgcgctgctcgggcgcg
gggctcggccccaccgtgcgcgcccggctgccccacagcgtcaacgtggactgcagcgcc
gcggggcgggcggcgctcgacgtcactctgctgggacccaccggcactccggagccggtg
gaggttcgggataacggcgatgggacccacagcgtcacctacagccccaccgctgtgggg
ccgcacagcctcagcatcgcctatggggggcaggaggtgccgcgcaccttcaagctgcag
gccgtcccccacgacgccagccgtgttttggcatcgggccccgggctgagcccttcgggg
gtccccgcctccctccccgtggagttcgccatcgacgcccgaagagccgggcagggagtg
ctgaccgtgcagatcctggaccccgagggccgccccacggaggcgtccatagaggaccac
ggggacgggacgttcacggtgcggtacctcccccgcctggtgggccgttacagcatcacc
gtgcgctacggcggcgacgacattcccgcctcccccttctgcatccacggcgcgcccagc
gggaacgccagcaagtgccacgtcaccggcggctgcgcgttcccgacgctccgcccggga
gagcgcactctgctggccgtggacgcgcgcgccgccgggcccgggaaggtcacgtgttcg
gtgctcagccccgacggcgccgaggtggacgtggacgtggccgagaatcccgacgggacg
ttccacgtgtcctacaccgcccccgagcccggcagctacggcctcaccgtgcgcttcggg
gggcagcacgtccccaactcgcccttccgcatcgtggcgacagcggagcccccacgcccc
cgagacctccggcccttcagcctggatctgccctgcgcccccctgaagggcgacatcacc
gcggaggttcggacgccgtcgggccgcaccgcgcgggcggaggtggcgcagagtggggac
ggaacggtggcggtgcggttcgagcccagcgagaaggggcggcacctcatggagctgcgc
tgcgacggcgaccctctgcccgggagccccctgcagttctatgtggacgcggtggacgcg
cggcacgtgagcgcctatggggccgggctgagccacggcgtcgtcaacaaagcctgcagc
ttcaccgtcatcaccaaaggagccggcgagggcggactgtctctggcggtggaggggccg
tcgaaggcggagctgagctgccacgacaaccacgacgggacgtgcaccgtatcctacgtg
cccaccgcgcccggcgactacagcgtcatcgtgcgcttcgacgacgaacacatcccgggc
agccccttcaccgccaagatcaccggcgacgactccctccgcacgtctcagctgaacgtc
gggacggccaccgacgtctccctgaagatctcggagacggatctgagccagctgacggcg
tccatccgcgccccgtcgggcagcgaggagccgtgtctgctcaaacgcctccccaaccga
cacatcggtatctccttcacgccgaaggaggtgggggagcacgtggtgagcgtgcggaag
ggggggcagcacgtcaccaacagcccctttaagatcgtggtggggccgtcggagatcggc
aacgccgagagggtgaaggtgtggggcaccgggctgagcgaggggcgcaccttccagctg
gcgcacttcgtcgtggacacgcgcagcgctgggtacggcggtctggggctgtcggtggag
gggccgagcaaggtggacatccactgcgaggacgccgaggacggcacctgcaaggtgtcc
tattgccccaccgagcccggcagctaccggctcagcgtcaagttcgccgagcagcacgtg
ccagggagcccattcacggtgaaggtgagcggggagggcagagtgaaggagagcatcacc
agggccaggcaggccgcctccatcgccgccatcggcagcgcctgcgacctcaacctcaag
atcccaggcaattggttccagatggtgtcagcccaggagcgtctgacgcgcacgttcacg
cgcagcagccacacttacacgcgcacggagcgcacggagatcagcaagacgcgcggcggg
gagaccacgcgggaggtgcgcgtgcaagagtccacgcgcgtgggagccgagcccttccac
ggcgtcttcgggggattccttggaggattcggggcggcggcgcgaggacaggaggatgca
gcccccccagagctgacggctcaggtgctcagcccttcggggcagcactcggaggcggag
gtgcaggcggggccgggaagcgcctatagggtgcgcttcgtgccggaggaattgggaccc
cacagcgtggccgttaagttccgggggcaacacgtgccgggcagccccttcccgttcacc
gtcggacccctcggtgaagggggggcgcatcgcgcaagggccggagggccggggctgcag
agaggggtggccggagtgccagcggagttcagcatctggacgcgcgaggcgggcgcgggg
gggctctccatcgccgtggaggggcccagcaaagccgagatcaacttcgaggaccgcaag
gacggctcctgcggggtcacttatctcgtgcaggagcccggtgactacgaggtgtccatt
aagttcaatgaggagcacatcccggacagcccctttgtggtcccggtggcgtcgcgctcc
gacgccgcgcagcattcaaccgtcagcagcgcgcaggaggcgctccgtgtgaaccacccg
gcggcgctgtcggtgcatttgaacggcgcccgccggccattcgacgccaaagtgctgagc
ccgaccggaaccgtcagcgaatgcagcgtgtccgaaatcgaccccgatctgtactccatc
gggtttctgcccgtggagaatggggtccacgcggtggaggtgcggctgaacggccgccac
gttccgggcagtcccttcaacgtccgcgtgggggagcagagccacgacgccgaccccggc
ctcgtcaccgcctatggggccggcctgcagggcggcgtcaccggggtgcgctcggagttc
gtggtgaagacggccaacgccggctccggggcgctgtcggtcaccattgacggcccctcc
aaggtgacgttggactgcgtggagtgcgccgagggccaccgcgtcacctacacccccatg
gcccccggcaactacctcatctccatcaagtatggcggcccccaccacatcgttggcagc
cccttcaaggccaaggtcaccggcccgcggctctcgggggggcacagcctccacgagacc
tcctcggtgctggtggagacggtgacccgcggggcgctgggcccccccggcttcgggacc
ctccccaaattctcgtcggatgccagcaaggtggtggcacgtgggccggggctcagcact
gccttcgtggggcagaagaaccacttcactgtcgactgcagcaaagcgggcagcaatatg
ctgatggtgggggtgcacggcccgaagacgccgtgcgaggaggtgtacgtaaagcacgtg
gggaaccgcctctacaacgtcacctacaccgtgaaggagaagggggaatacgtcctcatc
ctgcgctggggggacgacagcgtcccgggcagccccttccgcgtcaccgtgccatga

DBGET integrated database retrieval system