KEGG   Gallus gallus (chicken): 395260Help
Entry
395260            CDS       T01006                                 

Gene name
FLNC, filamin-C
Definition
(RefSeq) filamin C, gamma
  KO
K04437  
filamin
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    395260 (FLNC)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    395260 (FLNC)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    395260 (FLNC)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   395260 (FLNC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
Un
AA seq 2658 aa AA seqDB search
MNSSGYEETAVPEDAEELPAAEKELAEDAPWKKIQQNTFTRWCNEHLKCVNKSISDLQRD
LGDGLRLIALLEVLSQKKMGRKHHPRPNFRQMKLENVSVALEFLERERIKLVFIDSKAIV
DGNLKLILGLVWTLILHYSISLPMWEEEEEGARQQTPKQRLLGWVQHRVPQLRITNFNRD
WNDGRALGALVDNCAPGLCPDWQSWDPAQPVQNAREAMQQADDWLGVPQVIAPEEIADPN
VDEHSVMTYLSQFPKAKLKPGAPLRPRAVRPERVRAYGPGLEPQGNVVLQPARFTVETWT
RARQVLENARDHRAHHEEAQVVANNDEKRTFSVTYVPKVAGLHKVTVLFGGQNIPGSPFV
GVAMAHGDASKVSARGPGIEPSGNVANKPTYFDIYTAGAGSGDVGVVLEDPAGPRDTVEG
DMEDRGDSTFRCSYRPTLPGPHRVAVTFAGAHIPNSTFCVNVAEACNPSACRAWGRGLQP
KGLRVHETADFRVHTNAPAELRVTVPDRGTEVPVSVRPTADGVYECEYRPTVAGTHSVSI
TWGGYSIPRSPLEVEVSPAAGAQKVRAWGPGLHGGVVGDSADFVVEAIGDDVRTLGFSIE
GPSQPKIESDDPGDGSCDVRYWPTEAGPYPVHVVCDDEDIARSPFMAHIRPAAPDCSPDK
VKVWGPGLEPTGVIVNRPTEFCVDARAAGKGGLHIYAQDADGCPVDIAVKDNGDGTFSCH
YVPSKAIKHTVIVTWGGVNVPRSPFRVAVGKGSHPGRVRVYGPGVERAGLTAGEPTYFTV
DCSDAGQGDVSIGIKCCPALPGAAEADIDFTIIKNDNDTFTVKYTPPCAGLLTVMVLFGT
QELPCSPFRITVAPAHDSSKVRAEGPGISRTGVESGRPTHFTVQTRGAGKAPLDVQFGGA
AQSGVSDVQIIDNGDYSHTVKYTAMRQGELSVGVTYGGDPIPKSPFPVTVAPPLQLDKVS
VQGLSSKVPVGAPQSFSVLSSGAGGQGALSVTAMGAGRRSVPVAVESAGPGLHRARFTAA
EEGQLRFDVTYDGHPVPGSPFVVDAVLPPDPSKVHAFGPGLHGGVAGSPATFTISTRGAG
SGALGLTVEGPREAELECHDNGDGSCSVRYVPPEPGDYSLNILFAGTHVPGSPFRAAVRP
RFDATKVRADGPGLRSGRVGQIATFAVDCRDAGEAELNIEIRHELGARPEVRIHDNGDGT
YGISYTPARAGAYTVTVSYGGVPVPHFPACVTVEPDVDLSAIAVYGTGVEPRGPLRDVST
EFTVDARAVVPSGGPHVGARVTAPSGATTDCSVSDGGDGTYRVRYTPREEGVHQVEVTFQ
EVALPQSPFAVAVAEGCDPTRVSAHGPGLESGLVGRANCFTVQTRGAGTGGLGLAIEGPS
EAKMSCQDNKDGSCSVEYVPFAAGDYDVNITFGGRPIPGSPFRVRVSEPVDASQVRCSGA
GLGPTVRARLPHSVNVDCSAAGRAALDVTLLGPTGTPEPVEVRDNGDGTHSVTYSPTAVG
PHSLSIAYGGQEVPRTFKLQAVPHDASRVLASGPGLSPSGVPASLPVEFAIDARRAGQGV
LTVQILDPEGRPTEASIEDHGDGTFTVRYLPRLVGRYSITVRYGGDDIPASPFCIHGAPS
GNASKCHVTGGCAFPTLRPGERTLLAVDARAAGPGKVTCSVLSPDGAEVDVDVAENPDGT
FHVSYTAPEPGSYGLTVRFGGQHVPNSPFRIVATAEPPRPRDLRPFSLDLPCAPLKGDIT
AEVRTPSGRTARAEVAQSGDGTVAVRFEPSEKGRHLMELRCDGDPLPGSPLQFYVDAVDA
RHVSAYGAGLSHGVVNKACSFTVITKGAGEGGLSLAVEGPSKAELSCHDNHDGTCTVSYV
PTAPGDYSVIVRFDDEHIPGSPFTAKITGDDSLRTSQLNVGTATDVSLKISETDLSQLTA
SIRAPSGSEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKGGQHVTNSPFKIVVGPSEIG
NAERVKVWGTGLSEGRTFQLAHFVVDTRSAGYGGLGLSVEGPSKVDIHCEDAEDGTCKVS
YCPTEPGSYRLSVKFAEQHVPGSPFTVKVSGEGRVKESITRARQAASIAAIGSACDLNLK
IPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETTREVRVQESTRVGAEPFH
GVFGGFLGGFGAAARGQEDAAPPELTAQVLSPSGQHSEAEVQAGPGSAYRVRFVPEELGP
HSVAVKFRGQHVPGSPFPFTVGPLGEGGAHRARAGGPGLQRGVAGVPAEFSIWTREAGAG
GLSIAVEGPSKAEINFEDRKDGSCGVTYLVQEPGDYEVSIKFNEEHIPDSPFVVPVASRS
DAAQHSTVSSAQEALRVNHPAALSVHLNGARRPFDAKVLSPTGTVSECSVSEIDPDLYSI
GFLPVENGVHAVEVRLNGRHVPGSPFNVRVGEQSHDADPGLVTAYGAGLQGGVTGVRSEF
VVKTANAGSGALSVTIDGPSKVTLDCVECAEGHRVTYTPMAPGNYLISIKYGGPHHIVGS
PFKAKVTGPRLSGGHSLHETSSVLVETVTRGALGPPGFGTLPKFSSDASKVVARGPGLST
AFVGQKNHFTVDCSKAGSNMLMVGVHGPKTPCEEVYVKHVGNRLYNVTYTVKEKGEYVLI
LRWGDDSVPGSPFRVTVP
NT seq 7977 nt NT seq  +upstreamnt  +downstreamnt
atgaactcttcgggctacgaggagacggcggtgccggaggacgccgaggagctgccggcg
gccgagaaggagctggcggaggacgcgccgtggaagaagatccagcagaacacgttcacg
aggtggtgcaacgagcacctgaagtgcgtcaacaagagcatctcggacctgcagagggac
ctgggggacgggctgaggctcatcgctctgctggaggtgctgagccagaagaagatgggg
aggaagcatcaccccaggcccaacttccggcagatgaagctggagaacgtgtcggtggcg
ttggagttcctggagagggagaggatcaagctggtgttcatcgacagcaaagccatcgtg
gacgggaacctgaagctgatcctgggcctggtgtggacgctgatcctacactactccatc
tcgctgcccatgtgggaggaggaagaggagggcgcccggcagcagaccccaaagcagcgc
cttttggggtgggtgcagcaccgggtcccgcagctccgcatcaccaacttcaaccgagac
tggaacgacggccgcgcgctgggggcgctggtggacaactgcgcgcctgggctgtgcccg
gactggcagagctgggaccccgcgcagccggtgcagaacgcgcgcgaggcgatgcagcag
gccgatgattggctcggagtgccgcaggtgatcgccccggaggagatcgcggaccccaac
gtggacgagcactccgtgatgacgtatctgtcgcagttccccaaagccaaactgaagccc
ggcgcccctctgcggccgcgcgcggtgcggcccgaacgcgtccgcgcatatgggcccggg
ctggagccgcaggggaacgtggtgctgcagccggcgcgcttcacggtggagacgtggacg
cgggcacggcaggtgttggagaacgccagagaccaccgagcacaccacgaggaggcccag
gtggtggccaacaacgatgagaagaggaccttctctgtcacctacgtccccaaagtggcg
gggctgcacaaggtgacggtgctgtttggggggcagaacatccccgggagcccctttgtg
ggggtggcgatggctcacggcgatgccagcaaagtgtctgcgcgcggccccggcatcgaa
cccagcggcaacgtggccaacaaacccacctacttcgacatctacaccgcaggtgcgggt
tcgggtgacgtcggggtggtgttggaggaccccgcgggaccgcgtgacaccgtggagggt
gacatggaggaccgcggggacagcaccttccgctgctcctatcggcccaccctgcccggc
ccccaccgcgtcgccgtcaccttcgccggagcccacatcccaaacagcaccttctgcgtc
aacgtggccgaagcgtgcaacccttcggcgtgccgtgcgtgggggcgggggctgcagccc
aaagggctgcgcgtgcacgagacggccgacttccgcgtgcacaccaacgcgccggcagaa
ctgcgcgtcaccgtgccggaccgaggcacagaggttccggtgtcggtgcgccccacggct
gatggcgtttatgagtgcgaataccgccccactgtggccgggacccacagcgtctccatc
acgtgggggggatacagcatcccgaggagccccctggaggtggaggtgtctccggccgcg
ggcgctcagaaggtccgtgcgtgggggccggggctgcacggcggcgtcgtgggcgactcg
gccgacttcgtggtggaggctatcggggacgacgtacggactctggggttctccattgag
ggtccgtctcagccaaagatcgaatccgacgacccgggcgacggttcgtgcgacgttcgc
tattggcccacggaggcggggccgtaccccgtgcacgtcgtgtgcgacgatgaggacatc
gcccgcagccccttcatggcccacatccgccccgccgcccccgactgcagccccgacaag
gtgaaggtttggggtcccggcctggagcccacgggggtcatcgtcaaccgccccactgag
ttctgtgtggacgcccgcgctgccggaaagggggggctgcacatctatgcacaggacgcc
gacggctgcccggtggacatcgcagtgaaggacaacggggacggcaccttcagctgccat
tacgtccccagcaaagccatcaaacacaccgtcatcgtcacctgggggggggtcaacgtc
ccacgcagccccttccgggtggcggtggggaagggcagccatccgggccgcgtccgcgtc
tacgggccgggggtggagcgcgccgggctgacggcgggggagcccacctacttcaccgtg
gactgcagcgacgccgggcagggcgatgtcagcatcggcattaagtgctgcccggcgctg
cccggcgcggcggaggcggacatcgatttcaccatcataaagaacgacaacgatacgttc
accgtgaaatacaccccgccgtgcgccgggctgctcaccgtcatggtgctcttcgggacg
caggagctgccctgcagtccgttccgcatcacggtggccccggcccacgacagcagcaaa
gtgagagcagagggacccgggatcagccgcaccggcgtggagtcggggcgccccacgcac
ttcacggtgcagacgcggggggcggggaaggcccccctggacgtgcagtttgggggcgcg
gcgcagagcggcgtcagcgacgtgcagatcatcgacaacggcgactacagccacaccgtc
aaatacaccgccatgcggcagggggagctgtctgtgggggtgacttatgggggggatccg
atccccaaaagcccctttcccgtcaccgtggcgccgcctctgcagttggacaaagtgtcg
gtgcagggactgagcagcaaggttccggtgggcgccccgcagtcgttctcggtgctgagt
tccggcgccggcgggcagggggcgctgtcggtgacggcgatgggcgcggggcggcgctct
gttccggtggcggtggagtcggccgggccggggctgcaccgcgcgcggttcacggcggcc
gaagagggacagctccgcttcgacgtgacgtacgacggacaccccgtgccgggcagcccc
ttcgtggtggacgcggtgctgccccccgacccctccaaggtgcacgccttcggtccgggc
cttcacggcggcgtagcgggcagcccggccacgttcaccatctcgacccgcggcgccggt
tcgggcgcattgggtctgacggtggaaggaccccgagaggcggagctcgaatgccacgac
aacggagacggttcgtgttcggttcgctacgtaccgccggaaccgggcgattacagcctc
aacatcctcttcgccggtacccacgtgccgggatcgccgttccgagcggcggtccgaccc
cgtttcgacgccaccaaagtccgggcggacggccccggtttaaggagcggccgcgtgggt
cagatcgccactttcgccgtggattgccgcgacgcgggggaggcggagctcaacatcgag
atccgccacgagctcggagcgcggcccgaggtccgcatccacgacaacggcgacgggacg
tacggcatctcctacaccccggcccgggccggcgcctacaccgtcaccgtcagctacgga
ggagtgcccgtcccgcacttccccgcctgcgtcaccgtggagcccgacgtggatctcagc
gccattgcggtgtatggcaccggcgtggagcccaggggccctctccgtgacgtcagcacg
gagttcacggtggacgcgcgcgcggtggtcccttcgggcggtccccacgtgggggcgcgc
gtcaccgccccgtccggagccaccaccgactgcagcgtcagcgacggcggcgacgggacg
taccgcgtccggtacacgcccagagaggagggcgtgcaccaggtggaggtgacgttccag
gaggtggcgctgccgcagagccccttcgctgtggccgtggccgaaggctgcgaccccacg
cgtgtgagcgcccacgggcccggcctggagagcggcctggtgggcagagccaactgcttc
accgtgcaaacgcggggcgccgggacggggggtttggggttggccatcgagggtccttcg
gaggccaagatgtcgtgccaggacaacaaagatggcagctgctccgtggaatacgtcccc
ttcgcggccggggattacgatgtcaacatcaccttcggggggcggcccatccccggctct
ccgttccgcgtgcgcgtttcggagccggtggacgcgtctcaggtgcgctgctcgggcgcg
gggctcggccccaccgtgcgcgcccggctgccccacagcgtcaacgtggactgcagcgcc
gcggggcgggcggcgctcgacgtcactctgctgggacccaccggcactccggagccggtg
gaggttcgggataacggcgatgggacccacagcgtcacctacagccccaccgctgtgggg
ccgcacagcctcagcatcgcctatggggggcaggaggtgccgcgcaccttcaagctgcag
gccgtcccccacgacgccagccgtgttttggcatcgggccccgggctgagcccttcgggg
gtccccgcctccctccccgtggagttcgccatcgacgcccgaagagccgggcagggagtg
ctgaccgtgcagatcctggaccccgagggccgccccacggaggcgtccatagaggaccac
ggggacgggacgttcacggtgcggtacctcccccgcctggtgggccgttacagcatcacc
gtgcgctacggcggcgacgacattcccgcctcccccttctgcatccacggcgcgcccagc
gggaacgccagcaagtgccacgtcaccggcggctgcgcgttcccgacgctccgcccggga
gagcgcactctgctggccgtggacgcgcgcgccgccgggcccgggaaggtcacgtgttcg
gtgctcagccccgacggcgccgaggtggacgtggacgtggccgagaatcccgacgggacg
ttccacgtgtcctacaccgcccccgagcccggcagctacggcctcaccgtgcgcttcggg
gggcagcacgtccccaactcgcccttccgcatcgtggcgacagcggagcccccacgcccc
cgagacctccggcccttcagcctggatctgccctgcgcccccctgaagggcgacatcacc
gcggaggttcggacgccgtcgggccgcaccgcgcgggcggaggtggcgcagagtggggac
ggaacggtggcggtgcggttcgagcccagcgagaaggggcggcacctcatggagctgcgc
tgcgacggcgaccctctgcccgggagccccctgcagttctatgtggacgcggtggacgcg
cggcacgtgagcgcctatggggccgggctgagccacggcgtcgtcaacaaagcctgcagc
ttcaccgtcatcaccaaaggagccggcgagggcggactgtctctggcggtggaggggccg
tcgaaggcggagctgagctgccacgacaaccacgacgggacgtgcaccgtatcctacgtg
cccaccgcgcccggcgactacagcgtcatcgtgcgcttcgacgacgaacacatcccgggc
agccccttcaccgccaagatcaccggcgacgactccctccgcacgtctcagctgaacgtc
gggacggccaccgacgtctccctgaagatctcggagacggatctgagccagctgacggcg
tccatccgcgccccgtcgggcagcgaggagccgtgtctgctcaaacgcctccccaaccga
cacatcggtatctccttcacgccgaaggaggtgggggagcacgtggtgagcgtgcggaag
ggggggcagcacgtcaccaacagcccctttaagatcgtggtggggccgtcggagatcggc
aacgccgagagggtgaaggtgtggggcaccgggctgagcgaggggcgcaccttccagctg
gcgcacttcgtcgtggacacgcgcagcgctgggtacggcggtctggggctgtcggtggag
gggccgagcaaggtggacatccactgcgaggacgccgaggacggcacctgcaaggtgtcc
tattgccccaccgagcccggcagctaccggctcagcgtcaagttcgccgagcagcacgtg
ccagggagcccattcacggtgaaggtgagcggggagggcagagtgaaggagagcatcacc
agggccaggcaggccgcctccatcgccgccatcggcagcgcctgcgacctcaacctcaag
atcccaggcaattggttccagatggtgtcagcccaggagcgtctgacgcgcacgttcacg
cgcagcagccacacttacacgcgcacggagcgcacggagatcagcaagacgcgcggcggg
gagaccacgcgggaggtgcgcgtgcaagagtccacgcgcgtgggagccgagcccttccac
ggcgtcttcgggggattccttggaggattcggggcggcggcgcgaggacaggaggatgca
gcccccccagagctgacggctcaggtgctcagcccttcggggcagcactcggaggcggag
gtgcaggcggggccgggaagcgcctatagggtgcgcttcgtgccggaggaattgggaccc
cacagcgtggccgttaagttccgggggcaacacgtgccgggcagccccttcccgttcacc
gtcggacccctcggtgaagggggggcgcatcgcgcaagggccggagggccggggctgcag
agaggggtggccggagtgccagcggagttcagcatctggacgcgcgaggcgggcgcgggg
gggctctccatcgccgtggaggggcccagcaaagccgagatcaacttcgaggaccgcaag
gacggctcctgcggggtcacttatctcgtgcaggagcccggtgactacgaggtgtccatt
aagttcaatgaggagcacatcccggacagcccctttgtggtcccggtggcgtcgcgctcc
gacgccgcgcagcattcaaccgtcagcagcgcgcaggaggcgctccgtgtgaaccacccg
gcggcgctgtcggtgcatttgaacggcgcccgccggccattcgacgccaaagtgctgagc
ccgaccggaaccgtcagcgaatgcagcgtgtccgaaatcgaccccgatctgtactccatc
gggtttctgcccgtggagaatggggtccacgcggtggaggtgcggctgaacggccgccac
gttccgggcagtcccttcaacgtccgcgtgggggagcagagccacgacgccgaccccggc
ctcgtcaccgcctatggggccggcctgcagggcggcgtcaccggggtgcgctcggagttc
gtggtgaagacggccaacgccggctccggggcgctgtcggtcaccattgacggcccctcc
aaggtgacgttggactgcgtggagtgcgccgagggccaccgcgtcacctacacccccatg
gcccccggcaactacctcatctccatcaagtatggcggcccccaccacatcgttggcagc
cccttcaaggccaaggtcaccggcccgcggctctcgggggggcacagcctccacgagacc
tcctcggtgctggtggagacggtgacccgcggggcgctgggcccccccggcttcgggacc
ctccccaaattctcgtcggatgccagcaaggtggtggcacgtgggccggggctcagcact
gccttcgtggggcagaagaaccacttcactgtcgactgcagcaaagcgggcagcaatatg
ctgatggtgggggtgcacggcccgaagacgccgtgcgaggaggtgtacgtaaagcacgtg
gggaaccgcctctacaacgtcacctacaccgtgaaggagaagggggaatacgtcctcatc
ctgcgctggggggacgacagcgtcccgggcagccccttccgcgtcaccgtgccatga

DBGET integrated database retrieval system