KEGG   Gallus gallus (chicken): 395261Help
Entry
395261            CDS       T01006                                 

Gene name
FLNA
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    395261 (FLNA)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    395261 (FLNA)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    395261 (FLNA)
Exosome [BR:gga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   395261 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
Un
AA seq 2610 aa AA seqDB search
MSAAGRAREPEAEMPATEKDLADDAPWKRIQQNTFTRWCNEHLKCVQKRVGNLQTDLGDG
LRLIALLEVLSQKKLGRRYNARPTFRQMQLENVSVALDFLERENIKLVSIDSKAIVDGNL
KLILGLVWTLILHYSISMPVWEDEDEEEARRQTPKQRLLGWIQNRLPQLPVTNFSRDWSS
GRALGALVDSCAPGLCPDWESWDPERAVENAREAMQQADEWLGIPQVITPEEIVDPNVDE
HSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNVVKQRAEFTVETISAGQG
DVTVYVEDPEGHREEAKVVPNNDKNRTFSVSYVPKVTGVHKVTVLFAGQHIAKSPFEVAV
GRAAGDAGRVTAQGPGIEPTGNVANRTTHFDILTAGAGPGSPDVVVTDPGGRRVEALLEG
RGDGAFRCSYRPTAEGTHSVAVTFGGTPIPRSPFAVGVGQACNPSQCRAEGRGLQPKGLR
VKEAADFKVYTKGAGSGELKVAVKGPKGAKALKQKDLGEGVFGCEYTPTVPGAHSVTFTY
GGQPIPRSPFEVQVAPAGGAPKVRAWGRGLQGGMVGCSADFVVEALGDDVGTLGFSVEGP
SQARIECSDGGDGCCAVGYRPLEAGLYAVHVLCDGDDIAGSPFMATVRGPERGCCPDKVK
AQGPGLEPTGVAVNQPAEFTVDAKQAGKGPLTVQIQDSEGTPVEVAVKDRGDGTYSCSYT
PRKALKHTAVLAWGGVNIPHSPYRVSVGPGSHPNKVKVYGPGVGKTGLKAHEPTYFTVDC
SEQGQGDVSIGIKSAPGVVGPAEADLDFDILRNADDTFTVRYTPRGAGMHTVMVLFADQP
TPSSPIRVRVDPSHDASKVKAEGPGLSRTGLELGKPTQFTVLSKGAGRAALDVEVSGPGK
GDAVRDLEVRDNRDGTHTVTYTPVQQGNLEVSVKYGGDPIPKSPFGVTVSPAVELGRIKI
SGLDDKLEVGKEQEFTVKAKGAGGQGKVGARIVGPTHKAVPCRVEAGPGAESSVVRWTAP
HEGPYEVEVTYDGHPVPGSPFPVEAVPPTDPSKVRAFGPGLQGGQAGVPAPFTIDTKGAG
TGGLGLTVEGPCEAPIECQDHGDGTCSVSYLPAVPGDYTINILFAGAHVPGSPFRAPVAA
PFDPTKVTCEGPGLEKGVVGQRSHFRVDCSRAGSAELSIGIASDGGAQAEVCVEDNGDGT
YNIGYTALSPGPHSITVLYGGQPVPHFPAKVCVEPAGDAAAVKVYGPGVEGKGVFRGALT
HFEVDARALGAAGGAAVTARIRKPSGGGVEAAVEDRGDGTYGVQYTPYEEGVHTVEVSYG
GSPLPAGPFRVAVTEGCDPSRVRVHGPGIAGGTARQPNCFTVETRGAGTGGLGLAMEGPS
EAQLSCTDNKDGSCSVQYIPSAPGTYSLNVTYGGRRVPGSPFRVPVVETGGGGGAADAGM
VKCAGPGLTKGEVRVNPVQRFDVDCSKAGEAALDVKVVGPKGVVEPVEVTDNGDGTRSVS
YVPSREGPYSISVRYGDQEVPRSPFKVKALPSHDASKVRASGPGLNTSGVPASLPVEFTI
DAKDAGEGLLAVQITDPEGKPKKASIRDNGDGTYTVSYVPDTTGRYTILIKYGGDEIPYS
PYRIRAVPAGDASKCTVTGPGLGPTIQLGEQTLLTVDAKAAGPGKVTCAVRAPDGAEADV
DVVENADGTFDIFYTAPQPGKYIICVRFGGEHVPNSPFQVMATERPLLGVNGLDVGLRPF
DLVIPLTIAKGEITGEVRMPSGKVSRPAITDNKDGTVTVRFEPSEAGLHQMDIRYDSVHI
PGSPLQFYVDYVNSGHVTAYGPGLTHGTVNKAAQFTVNTKDAGEGGLSLAVEGPSKAEIS
CTDHQDGTCTVSYLPVLPGDYSIVVKYNDKHIAGSPFTARITGDDSLRQSHLKVGASADI
PLDIAESDLSQLAASVTAPSGRKEPCQLKRLRDGHVGISFVPQEVGEHLVHISRGGQPLP
RSPITVSISQAELGDAARVRVGGPGLHEGRTLTPTHFTIDTRDAGYGGLSLSIEGPSKVD
ISTEELPDGTCRVGYCPTEPGNYIIAVQFGEQHVPGSPFSVKVTGEGRVKESITRRRRAP
PEAHVGTACDLSLKMPEPTAHDVTAQVTAPSGTSMAAQVLEGERGAYSIRFVPEESGVHS
VSVKDRGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAETGVPAEFSIWTREAGAGGL
SISVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVAVKFNEEHIPDSPFVVTAAPNSDA
ARRLTVSSLRESGLKVHQPASFAVSLNGAKGALDAKVHSPSGAVEECHISEVTEDKYAVR
FIPRENGVYSIDVKFDGAHIPGSPFKVRVGDPGQAGDPGLVTAYGAGLEGGTTGSPAEFV
VNTLHAGPGALSVTIEGPSKVKMECVECPEGFRVVYTPMAPGSYLIAIKFGGPHHIAGSP
FKAKVTGPRLVSTHSLRESSSVLVDSGMGGGVSVPPPSATAAAPSSTSAPPGGVPQFSDP
SKVVAKGLGLSKAFVGQRNSFTVDCSKAGSNMLLVGIQGPRAPCEELQVKHLGRQLYSVA
YVVRERGEHLLVLKWGDHHVPHSPFRITVP
NT seq 7833 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcggggcgggcgcgcgagcccgaggccgagatgccggcgaccgagaaggac
ctggcggacgacgctccgtggaagcggatccagcagaacacgttcacgcggtggtgcaac
gagcacctgaagtgcgtgcagaaacgagtgggcaacctgcagaccgacctgggcgacggg
ctgaggctcatcgcgctgctcgaggtgctgagccagaagaagctcggccggaggtacaac
gcccggcccacgttccggcagatgcagctcgagaacgtgtcggtggccctcgacttcttg
gagagagagaatatcaagttggtgtccatcgacagcaaagccatcgtggatgggaacctg
aagctgatcctgggcctggtgtggacgctgatcctgcactactccatctccatgcccgtg
tgggaggacgaggacgaggaggaggcgcggcggcagacccccaagcagcgcctgctgggc
tggatccagaaccggctgccgcagctccccgtcaccaacttcagccgcgactggagcagc
ggcagggcgctgggggcgctggtggacagctgtgctccagggctgtgccccgactgggag
tcgtgggacccggagcgcgccgtggagaacgcgcgcgaggcgatgcagcaggccgatgag
tggctcggcatcccgcaggtgatcaccccggaggagatcgtggaccccaacgtggacgag
cactcggtgatgacgtacctgtcgcagttccccaaggccaagctgaagcccggcgccccg
ctgcgccccaaactcaaccccaagaaggcgcgcgcctacgggcctggcattgagcccaca
gggaacgtggtgaagcagcgcgccgagttcacagtggagaccatcagtgcggggcagggg
gacgtgaccgtgtacgtggaggaccccgaggggcaccgtgaggaggcgaaagtggtgccg
aacaacgacaagaaccggacgttcagcgtctcctacgtgcccaaagtgaccggcgtgcac
aaggtgacggtgctgtttgcggggcagcacatcgccaagagccccttcgaggtggcggtg
ggccgcgcggccggcgatgcgggccgtgtgacggcgcaggggcccggcattgagcccacc
ggcaacgtggccaacagaaccacgcacttcgacatcctcactgccggcgccgggccgggc
agccccgacgtggtggtgacggatcccggcgggcgccgcgtggaggcgctgttggagggg
cgcggcgacggcgcgttccgctgctcgtaccgccccacggccgaggggacccacagcgtc
gcggtcaccttcggggggacccccatcccgcgcagccccttcgccgtcggcgtggggcag
gcgtgtaacccgtcgcagtgccgcgctgaggggagggggctgcagccgaaggggctgcgg
gtgaaggaggcggcggacttcaaggtgtacaccaaaggggcgggcagcggcgagctgaag
gttgccgtcaaagggcccaagggcgcgaaggcgttgaagcagaaggatttgggggagggg
gtgtttggctgcgaatacacccccactgtgcccggagcgcacagcgtcacgttcacctac
ggcggacagcccatcccccgcagccccttcgaggtgcaggtggccccggcggggggcgcc
cccaaagtgcgggcctgggggcgggggctgcagggcggcatggtgggctgctcggccgac
ttcgtggtggaggcgctgggagacgacgtgggaacgttgggcttttcggtggagggtccg
tctcaggcgcgcattgagtgcagcgacggcggtgacggctgctgcgcggtgggctatcgg
ccgctggaggcggggctgtacgccgtgcacgtgctgtgcgacggcgacgacatcgcgggc
agccccttcatggccaccgtgcgcggccccgagcgcggctgctgccccgacaaggtgaag
gcgcagggtcccggcctggagcccaccggcgtggcggtcaatcagccggctgagttcact
gtggatgccaaacaggcggggaagggacccctcacggtgcagatacaggactcggagggg
acgccggtggaggtggcggtgaaggaccgcggggacggaacgtacagctgcagttacacc
ccacggaaagccctgaagcacaccgccgtgctggcgtggggcggagtcaacatcccccac
agcccctatagggtgagcgtggggccgggcagccaccccaataaggtgaaggtttacggc
cccggagtgggcaaaacggggctgaaggcccacgaacccacatacttcactgtggactgc
agcgaacaggggcagggcgatgtgagcatcggcattaagagcgccccgggcgtggtgggc
ccggcggaggccgacctggacttcgacattctgcgcaacgccgacgatacgttcactgtg
cgctacaccccgcggggcgccgggatgcacaccgtcatggtgctcttcgccgaccagccg
acccccagcagccccatccgggtccgcgtcgacccctcacacgacgccagcaaagtgaag
gcggaggggccggggctcagccgcaccgggctggagctggggaagcccacgcagttcacg
gtgctgagcaaaggcgccgggcgcgccgcgctggacgtggaggtgagcgggcccggaaag
ggcgacgccgtgcgggacctcgaggtgcgcgacaaccgcgacgggacacacaccgtcaca
tacacccccgtgcagcagggtaacctggaggtgtcagtgaagtacggaggagaccccatc
cccaaaagcccttttggggtcaccgtgagccccgccgtggagctggggaggattaagatc
tccgggctggacgacaagctggaggtgggcaaggagcaggagttcacggtgaaggcgaag
ggcgccggggggcagggcaaagtgggggcccgaattgtggggccgacccacaaagccgtg
ccgtgccgcgtggaggcggggccgggcgccgagagcagcgtggtgcgttggaccgccccc
cacgagggaccctacgaggtcgaggtcacctatgatgggcaccccgtccccgggagcccc
ttccccgtcgaggctgtgccccccaccgacccatccaaggttcgcgccttcggtccgggc
cttcagggcggccaggcgggggtcccggccccgttcaccatcgacaccaaaggggcgggc
acgggggggctggggctgacggtggaggggccctgcgaagcccccatcgagtgccaggac
cacggcgacggcacgtgctccgtgtcctacctgcccgccgtgcccggcgactacaccatc
aacatcctcttcgcgggcgcccacgtgccggggtcccccttccgcgcccccgtggcggcc
cccttcgaccccaccaaagtgacctgcgagggtcccggcttggagaagggggtggtgggg
cagcgcagccacttccgcgtggactgcagccgcgccggcagcgcggagctcagcatcggc
atcgcgtcggacgggggggcgcaggcggaggtgtgcgtggaggacaacggcgacggcacg
tacaacatcggctacacggcgctcagccccgggccgcacagcatcaccgtgctctacggc
gggcagcccgtgccacacttcccggccaaggtctgcgtggagcccgcgggggacgccgcc
gccgtcaaagtctacgggccgggggtggagggcaagggggtgttccgtggggcgctgacg
cacttcgaggtggacgcgcgggcgttgggcgctgccggtggggctgcggtgacggcgcgg
attcggaagccctccgggggcggtgtggaggcggcggtggaggaccgcggagacggcacc
tatggggtgcagtacacaccctatgaggaaggcgtgcacacggtggaggtttcgtacggc
ggttccccgctgcccgccgggccgttccgcgtcgccgtcaccgaaggctgcgaccccagc
agggtgcgcgtccacgggcccggcatcgccggcggcaccgcgcggcagccaaactgcttc
accgtcgagacgcgcggtgcaggcacgggcgggctgggcctggccatggagggcccatcg
gaggcgcagctgtcgtgcacggacaacaaggacggcagctgctccgtgcagtacatcccc
agcgcccccggcacgtacagcctcaacgtcacctacggggggcggagggtcccgggcagc
cccttcagggtccccgtggtggagacgggggggggcgggggggcggcggatgcggggatg
gtgaagtgtgcggggccggggctgaccaaaggggaggtgagggtcaaccccgtgcagagg
ttcgacgtggactgcagcaaagccggggaggcggcgctggacgtcaaggtggtggggccc
aaaggtgtggtggagccggtggaggtgaccgacaatggggacgggacgaggagtgtcagc
tacgtcccatcccgcgaggggccctacagcatctccgtgcgctacggggaccaggaggtg
ccccgaagccccttcaaggtgaaggcgctgccgtcgcacgacgccagcaaagtgcgcgcc
tccgggccgggcctcaacaccagcggcgtccccgcatcgctgcccgtcgagttcaccatc
gacgccaaagatgccggggagggactgctggctgtgcagatcacggaccccgagggcaaa
cccaagaaggcgtcgatccgcgacaacggggacgggacgtacaccgtgtcctacgtcccc
gacaccaccgggcgctacaccatcctcatcaagtatggcggcgacgagatcccctattcc
ccgtaccgcatccgcgccgtccccgccggcgacgccagcaaatgcaccgtcaccggcccg
gggttgggccccaccatccagctgggggagcagacgctgctgacggtggacgcgaaggcg
gcggggccggggaaggtgacgtgtgccgtgcgcgcgcccgacggcgccgaggccgacgtg
gacgtggtggagaacgccgacggtaccttcgacatcttctacaccgccccccagcccggg
aagtacatcatctgcgtgcgcttcgggggggagcacgtccccaacagccccttccaggtc
atggcgacggagcggccgctgctgggtgtgaacgggttggatgtggggctgcggcccttc
gacctcgtcatcccgctcaccatcgccaagggggagatcaccggggaggtgcggatgccg
tccgggaaggtttctcgcccggccattacggacaataaggacggcaccgtcacggtgcgc
ttcgagcccagcgaggcggggctgcaccagatggacatccgctacgacagcgtccacatc
ccaggcagccccctgcagttctacgtggactacgtgaacagcggtcacgtgaccgcctac
ggccccgggctgacccacggcaccgtcaacaaagcggcccaattcaccgtcaacaccaaa
gatgccggcgaggggggtctctcgttggccgttgagggtccgtccaaggcagagatcagc
tgcacggaccaccaggacggcacctgcacggtttcctacctgccggtgctgccgggcgat
tacagcatcgtggtgaagtacaacgacaaacacatcgcggggagccccttcacggcccgc
atcaccggggacgacagtctgcgccaatcgcacctgaaggtgggcgcctcagccgacatc
ccattggacatcgccgagagcgacctcagccaattggctgccagcgtcaccgccccgtcc
ggccgcaaggagccctgccagctgaagcgcctccgcgacggacatgtcgggatctccttc
gtcccccaggaggtgggggagcacctggttcacatctcccggggggggcagccgctgccc
cgcagccccataacggtgagcatcagtcaggccgagctgggagacgccgcccgcgtccgc
gtgggggggccggggctgcacgaggggagaaccttaacccccacccacttcaccatcgac
accagggatgccgggtacggcgggctgagcctctccatcgaggggccgagcaaagtggac
atcagcaccgaggagctgccggatgggacctgcagggtgggctactgccccaccgagccg
ggcaactacatcatcgccgtgcagttcggcgagcagcacgtgcctgggagccccttctca
gtgaaggtgaccggggagggccgtgtgaaggagagcatcactcggcggcgccgcgccccc
cccgaagcccacgtgggcacagcctgcgacctcagcctcaaaatgccggagcccaccgcc
cacgacgtgacggctcaggtgacggcaccttcgggtacctccatggccgctcaggtcctg
gaaggggaaaggggggcctacagcatccgcttcgtccccgaggagagcggggtgcattcg
gtcagcgtgaaggatcggggtcagcacgtcccggggagccccttccagttcaccgtggga
cccctcggagaggggggggcccacaaagtgcgtgctggggggccgggcctggaaagggcc
gaaactggggtgccagcggagttcagtatctggacgcgcgaggcgggcgccgggggtctc
tccatctccgtggaggggcccagcaaagctgagatcgccttcgaggaccgcaaggacggc
tcctgtggggtctcctacgtggtgcaggagcccggggactacgaggtggcggtgaagttc
aacgaggagcacatcccggacagcccgtttgtggtgacggccgccccgaacagcgacgcc
gcgcgccgcctcactgtttctagccttcgggagtcggggctgaaggtgcaccaacccgcc
tccttcgccgtcagcctcaatggggccaaaggggccctggatgccaaagttcacagcccg
tccggagccgtggaggagtgccacatctccgaggtcaccgaagataaatacgccgtgcgt
ttcatcccgcgggagaacggcgtttattccatcgacgtgaaattcgacggcgcccacatc
ccggggagcccctttaaggtccgcgttggggaccccgggcaggcgggagaccccggcctc
gtcaccgcctatggggcgggcctggagggcggcaccaccggctccccggctgagtttgtg
gtgaacactttgcacgccggccccggggctctttcggtcaccattgagggcccatccaaa
gtgaagatggaatgcgtggagtgccccgaaggcttccgggtcgtttacaccccgatggcg
cccggcagttacctcatagccatcaaattcggggggccgcatcacatcgcggggagcccc
ttcaaggccaaagtcaccggaccccgcctggtcagcacccactccctccgcgagagctcc
tcagtgttggtggactccgggatgggggggggcgtttccgtgcccccccccagcgccacc
gccgccgccccctcctcaacctccgccccccccgggggggtcccccaattttctgacccc
tccaaagtggtggcgaaaggtttggggctcagcaaagcttttgtggggcagcgcaactcc
ttcactgtggactgcagcaaagcaggctccaacatgctgctggtgggcattcagggcccg
cgggcgccgtgcgaggagctgcaggtgaagcatttggggcggcagctgtacagcgtggcc
tacgtggtgcgcgagcggggggagcacctcctggtcctcaaatggggcgaccaccacgtc
ccgcacagccccttccgcatcaccgtgccctga

DBGET integrated database retrieval system