KEGG   Gallus gallus (chicken): 395272Help
Entry
395272            CDS       T01006                                 

Gene name
CLTC, CHC
Definition
clathrin, heavy chain (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
gga  Gallus gallus (chicken)
Pathway
Lysosome
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:gga04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:gga04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
19
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISDKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAQHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWASVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANASGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYEAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYKAVQFYLEFKPLLLNDLLMVLSPRLDHTRAVTFFT
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFIIEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDRLYKDAMQYASESKDTELAEELLQWFLQE
NKKECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaatactgccgatccgcttccaggagcacctccagctccaaaatctgggcatc
aacccagcaaacattgggttcagcactctgacgatggagtcagacaaattcatctgcata
agagagaaagtaggagaacaggctcaagtggtgatcattgacatgaatgaccccagcaac
ccaattcgaagaccaatttcagctgacagtgctatcatgaaccctgccagtaaagtcatt
gcgttaaaagctggaaaaacgcttcaaatatttaacattgaaatgaagagcaaaatgaag
gctcatacgatgacagatgacgtcaccttctggaagtggatctctctgaatactgttgcc
cttgtaacggataatgcagtctaccattggagtatggagggggagtcccagcctgtgaaa
atgtttgatcgccactctagtcttgctggctgccagatcatcaactaccgtactgatgca
aagcagaaatggctactgctaactggcatatctgcacagcaaaaccgtgttgtgggagca
atgcagctctattctgtagacagaaaagtttcacagccgatcgaggggcacgcagctagc
tttgcgcagttcaagatggaaggaaacgctgaagaatccactctcttctgttttgcagta
agagggcaagctgggggtaagttgcacatcatcgaggttggcacaccaccaacggggaat
cagcccttcccaaagaaagcagtggatgtcttctttcctcctgaagcacagaatgacttt
cctgttgcgatgcagatcagcgacaagcatgatgtggtgtttctgataacaaagtatggc
tatatccacttgtatgacctggaaactggcacctgtatctacatgaacagaatcagtgga
gagaccatatttgttactgcacagcatgaagcaacagctggaattataggagtaaacagg
aagggacaagtgttatcagtttgtgtggaagaagagaatattattccctacatcacaaat
gttctgcagaatcctgacctagctttacggatggctgtccgcaacaacctggctggagct
gaggaactttttgccagaaaattcaatgcattgtttgcacaagggaactattcagaggca
gcaaaagtggcagctaatgccccaaagggaattctgcgtactccagacaccatacgccgt
ttccagagtgttccagcacaaccaggacagacttcccctttactccagtattttggtatt
ctgcttgaccaagggcagctgaataagtatgagtctctggaactttgcagaccagtgctt
cagcagggacgcaaacaacttctggaaaaatggttaaaggaagataagctggagtgctca
gaggagctgggagaccttgtgaaatctgtagaccctacgctagcacttagtgtctatctg
agagccaatgttccaaacaaagtcatccagtgttttgctgaaacaggacaagtccagaag
attgttttgtatgctaagaaggttggatatactccagactggattttcttgctgaggaac
gtaatgagaatcagccctgatcaaggacagcagtttgcccaaatgcttgttcaagatgaa
gagcctcttgcagacataacacaaattgtggatgtttttatggaatataacttaattcag
caatgtactgccttcttgctggatgcactgaagaataatcgtccctcagaaggtcccctg
caaacacgtttacttgagatgaacctcatgcatgcaccccaggttgcagatgctatcctg
ggaaaccaaatgtttactcattatgatcgggctcacatagctcagctgtgtgagaaagct
ggcttgctgcagagagcactcgaacacttcacagacttgtatgacatcaagcgtgcagta
gttcacactcatcttctcaatcctgagtggctagtgaactactttggctccttgtcagta
gaagattcgctggagtgtttgcgtgctatgttatctgccaacattcgtcagaacctgcag
atctgtgtccaggtagcttcaaaataccacgaacagctatcaacacagtcacttattgag
ctgtttgagtccttcaagagctttgaaggtttgttttatttcctgggctccattgtaaac
tttagccaggatccagatgtgcacttcaagtatattcaagctgcatgcaagacaggacag
attaaagaagtagaaagaatctgcagggagagcaactgctatgatccagaacgtgttaaa
aacttcctcaaggaagctaaactcactgaccagctaccactcatcattgtgtgtgatcgc
ttcgactttgtccacgacttggtgctgtacctatatagaaataatctccaaaaatatatt
gagatttatgtacagaaggtgaatccaagccgcctacctgttgttattgggggactgctt
gatgtggattgctctgaagatgtgataaagaacctcatccttgtagtgagaggccagttt
tcaactgatgaacttgttgcagaagttgagaaaagaaataggctgaaactacttctgccc
tggctggaggcaagaattcatgagggttgtgaggagcctgcaacacacaacgcattggct
aaaatatacattgatagcaacaacaacccagaaagatttttgcgtgagaatccttactat
gatagccgagttgttggcaagtactgtgagaagagggacccgcacctggcctgcgtggct
tatgaacgtggacagtgtgatttggaactgatcaatgtgtgcaatgagaactctctcttc
aaaagcctttcccgctacttagttcgccgtaaagaccctgaactgtgggccagtgtgctg
ctggaaagcaacccgtacagaagaccactaattgaccaggttgtacagactgcactgtca
gagacccaggatcctgaggaggtgtctgttactgtgaaggccttcatgactgcagatctt
cccaatgagcttattgaactgctggagaaaatagttctcgataactctgtattcagtgag
cacaggaacctgcagaacctgctaattcttacagctattaaggctgatcgcacccgtgtc
atggaatacatcaatcgcctggataactatgatgctccagacatagccaatatagctatc
agtaatgagctctttgaggaggcatttgccatcttcaggaagtttgatgtaaacacatcg
gctgtacaggtattaatagagcacattggaaacctggatcgtgcgtatgaatttgctgaa
cgctgcaatgagcctgctgtgtggagtcagctggctaaagcacagcttcagaaagggatg
gtaaaggaagcaattgattcatacattaaagcagatgatccttcctcgtacatggaagtt
gttcaagctgccaatgccagtggaaactgggaagaactggtgaaatatcttcagatggca
cgcaagaaggcccgggaatcatatgtggaaacagaattaatctttgctcttgctaaaaca
aaccgtctggcagagctagaagaatttatcaatggacccaacaatgcacatatccagcaa
gttggtgatcgctgttatgatgaaaagatgtatgaagctgctaagctgttgtataacaat
gtgtccaactttggccgtttagcctctactttagttcacctgggtgaataccaggcggct
gtggatggtgctcggaaagcaaacagtactcgcacgtggaaagaggtctgctttgcttgt
gttgatggaaaagaattccgcctggcccagatgtgtggacttcatattgtagtgcatgca
gatgagttggaagagctaatcaattattaccaggatcgtggctactttgaagagctgata
actatgttggaagcagcacttggacttgagcgagcacacatggggatgtttacagagtta
gcaattctttactccaagttcaaaccacagaagatgagggagcacttggaactgttctgg
tccagagtcaacatccccaaggttctgagagctgcagaacaagcccatctctgggctgaa
ttggtgttcttatatgataagtatgaagaatacgataacgccataatcacaatgatgaat
cacccaacagatgcttggaaggaaggacaattcaaagatatcataactaaggtggccaat
gtggagctgtactacaaagcagttcaattctacttagaattcaaacctctgttgctcaat
gatctgctgatggtactgtcccctcgacttgaccatactcgtgctgtcaccttcttcaca
aaggttaaacagctacccctggttaaaccttacttgcgctctgttcaaaatcacaacaac
aaatcagtgaatgagtccctgaacaacctcttcattattgaagaagactaccaggccctt
aggacttctatagatgcttatgacaactttgacaacatttctcttgctcaacgtttggag
aagcacgagctgatagagttccgaaggattgctgcatatctgttcaaaggaaacaatcgc
tggaagcagagtgtggagctctgtaagaaagacagactgtataaggatgcaatgcagtat
gcttcagaatccaaagatactgagttggcagaagaattgttgcagtggttcttgcaggag
aacaagaaagaatgttttggtgcttgtctctttacctgctatgatcttttaaggcctgac
gttgtcttggaaacagcatggaggcacaacatcatggactttgccatgccatactttatt
caggtcatgaaggaatacttgaccaaggtggataaactggatgcatcagagtccttgaga
aaggaagaggagcaagctactgaaacacaacctattgtttatggtcagccacagctcatg
ttgacagcaggacccagtgttgcagttcctccacaagcaccttttggctatggttacact
gcaccaccatacgggcaaccgcagccaggctttgggtacagcatgtaa

DBGET integrated database retrieval system