KEGG   Gallus gallus (chicken): 395272Help
Entry
395272            CDS       T01006                                 

Gene name
CLTC, CHC
Definition
clathrin, heavy chain (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
gga  Gallus gallus (chicken)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:gga00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    395272 (CLTC)
   04142 Lysosome
    395272 (CLTC)
Exosome [BR:gga04147]
 Exosomal proteins
  Proteins found in most exosomes
   395272 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
19
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISDKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAQHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWASVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANASGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYEAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYKAVQFYLEFKPLLLNDLLMVLSPRLDHTRAVTFFT
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFIIEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDRLYKDAMQYASESKDTELAEELLQWFLQE
NKKECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaatactgccgatccgcttccaggagcacctccagctccaaaatctgggcatc
aacccagcaaacattgggttcagcactctgacgatggagtcagacaaattcatctgcata
agagagaaagtaggagaacaggctcaagtggtgatcattgacatgaatgaccccagcaac
ccaattcgaagaccaatttcagctgacagtgctatcatgaaccctgccagtaaagtcatt
gcgttaaaagctggaaaaacgcttcaaatatttaacattgaaatgaagagcaaaatgaag
gctcatacgatgacagatgacgtcaccttctggaagtggatctctctgaatactgttgcc
cttgtaacggataatgcagtctaccattggagtatggagggggagtcccagcctgtgaaa
atgtttgatcgccactctagtcttgctggctgccagatcatcaactaccgtactgatgca
aagcagaaatggctactgctaactggcatatctgcacagcaaaaccgtgttgtgggagca
atgcagctctattctgtagacagaaaagtttcacagccgatcgaggggcacgcagctagc
tttgcgcagttcaagatggaaggaaacgctgaagaatccactctcttctgttttgcagta
agagggcaagctgggggtaagttgcacatcatcgaggttggcacaccaccaacggggaat
cagcccttcccaaagaaagcagtggatgtcttctttcctcctgaagcacagaatgacttt
cctgttgcgatgcagatcagcgacaagcatgatgtggtgtttctgataacaaagtatggc
tatatccacttgtatgacctggaaactggcacctgtatctacatgaacagaatcagtgga
gagaccatatttgttactgcacagcatgaagcaacagctggaattataggagtaaacagg
aagggacaagtgttatcagtttgtgtggaagaagagaatattattccctacatcacaaat
gttctgcagaatcctgacctagctttacggatggctgtccgcaacaacctggctggagct
gaggaactttttgccagaaaattcaatgcattgtttgcacaagggaactattcagaggca
gcaaaagtggcagctaatgccccaaagggaattctgcgtactccagacaccatacgccgt
ttccagagtgttccagcacaaccaggacagacttcccctttactccagtattttggtatt
ctgcttgaccaagggcagctgaataagtatgagtctctggaactttgcagaccagtgctt
cagcagggacgcaaacaacttctggaaaaatggttaaaggaagataagctggagtgctca
gaggagctgggagaccttgtgaaatctgtagaccctacgctagcacttagtgtctatctg
agagccaatgttccaaacaaagtcatccagtgttttgctgaaacaggacaagtccagaag
attgttttgtatgctaagaaggttggatatactccagactggattttcttgctgaggaac
gtaatgagaatcagccctgatcaaggacagcagtttgcccaaatgcttgttcaagatgaa
gagcctcttgcagacataacacaaattgtggatgtttttatggaatataacttaattcag
caatgtactgccttcttgctggatgcactgaagaataatcgtccctcagaaggtcccctg
caaacacgtttacttgagatgaacctcatgcatgcaccccaggttgcagatgctatcctg
ggaaaccaaatgtttactcattatgatcgggctcacatagctcagctgtgtgagaaagct
ggcttgctgcagagagcactcgaacacttcacagacttgtatgacatcaagcgtgcagta
gttcacactcatcttctcaatcctgagtggctagtgaactactttggctccttgtcagta
gaagattcgctggagtgtttgcgtgctatgttatctgccaacattcgtcagaacctgcag
atctgtgtccaggtagcttcaaaataccacgaacagctatcaacacagtcacttattgag
ctgtttgagtccttcaagagctttgaaggtttgttttatttcctgggctccattgtaaac
tttagccaggatccagatgtgcacttcaagtatattcaagctgcatgcaagacaggacag
attaaagaagtagaaagaatctgcagggagagcaactgctatgatccagaacgtgttaaa
aacttcctcaaggaagctaaactcactgaccagctaccactcatcattgtgtgtgatcgc
ttcgactttgtccacgacttggtgctgtacctatatagaaataatctccaaaaatatatt
gagatttatgtacagaaggtgaatccaagccgcctacctgttgttattgggggactgctt
gatgtggattgctctgaagatgtgataaagaacctcatccttgtagtgagaggccagttt
tcaactgatgaacttgttgcagaagttgagaaaagaaataggctgaaactacttctgccc
tggctggaggcaagaattcatgagggttgtgaggagcctgcaacacacaacgcattggct
aaaatatacattgatagcaacaacaacccagaaagatttttgcgtgagaatccttactat
gatagccgagttgttggcaagtactgtgagaagagggacccgcacctggcctgcgtggct
tatgaacgtggacagtgtgatttggaactgatcaatgtgtgcaatgagaactctctcttc
aaaagcctttcccgctacttagttcgccgtaaagaccctgaactgtgggccagtgtgctg
ctggaaagcaacccgtacagaagaccactaattgaccaggttgtacagactgcactgtca
gagacccaggatcctgaggaggtgtctgttactgtgaaggccttcatgactgcagatctt
cccaatgagcttattgaactgctggagaaaatagttctcgataactctgtattcagtgag
cacaggaacctgcagaacctgctaattcttacagctattaaggctgatcgcacccgtgtc
atggaatacatcaatcgcctggataactatgatgctccagacatagccaatatagctatc
agtaatgagctctttgaggaggcatttgccatcttcaggaagtttgatgtaaacacatcg
gctgtacaggtattaatagagcacattggaaacctggatcgtgcgtatgaatttgctgaa
cgctgcaatgagcctgctgtgtggagtcagctggctaaagcacagcttcagaaagggatg
gtaaaggaagcaattgattcatacattaaagcagatgatccttcctcgtacatggaagtt
gttcaagctgccaatgccagtggaaactgggaagaactggtgaaatatcttcagatggca
cgcaagaaggcccgggaatcatatgtggaaacagaattaatctttgctcttgctaaaaca
aaccgtctggcagagctagaagaatttatcaatggacccaacaatgcacatatccagcaa
gttggtgatcgctgttatgatgaaaagatgtatgaagctgctaagctgttgtataacaat
gtgtccaactttggccgtttagcctctactttagttcacctgggtgaataccaggcggct
gtggatggtgctcggaaagcaaacagtactcgcacgtggaaagaggtctgctttgcttgt
gttgatggaaaagaattccgcctggcccagatgtgtggacttcatattgtagtgcatgca
gatgagttggaagagctaatcaattattaccaggatcgtggctactttgaagagctgata
actatgttggaagcagcacttggacttgagcgagcacacatggggatgtttacagagtta
gcaattctttactccaagttcaaaccacagaagatgagggagcacttggaactgttctgg
tccagagtcaacatccccaaggttctgagagctgcagaacaagcccatctctgggctgaa
ttggtgttcttatatgataagtatgaagaatacgataacgccataatcacaatgatgaat
cacccaacagatgcttggaaggaaggacaattcaaagatatcataactaaggtggccaat
gtggagctgtactacaaagcagttcaattctacttagaattcaaacctctgttgctcaat
gatctgctgatggtactgtcccctcgacttgaccatactcgtgctgtcaccttcttcaca
aaggttaaacagctacccctggttaaaccttacttgcgctctgttcaaaatcacaacaac
aaatcagtgaatgagtccctgaacaacctcttcattattgaagaagactaccaggccctt
aggacttctatagatgcttatgacaactttgacaacatttctcttgctcaacgtttggag
aagcacgagctgatagagttccgaaggattgctgcatatctgttcaaaggaaacaatcgc
tggaagcagagtgtggagctctgtaagaaagacagactgtataaggatgcaatgcagtat
gcttcagaatccaaagatactgagttggcagaagaattgttgcagtggttcttgcaggag
aacaagaaagaatgttttggtgcttgtctctttacctgctatgatcttttaaggcctgac
gttgtcttggaaacagcatggaggcacaacatcatggactttgccatgccatactttatt
caggtcatgaaggaatacttgaccaaggtggataaactggatgcatcagagtccttgaga
aaggaagaggagcaagctactgaaacacaacctattgtttatggtcagccacagctcatg
ttgacagcaggacccagtgttgcagttcctccacaagcaccttttggctatggttacact
gcaccaccatacgggcaaccgcagccaggctttgggtacagcatgtaa

DBGET integrated database retrieval system