KEGG   Gallus gallus (chicken): 395274Help
Entry
395274            CDS       T01006                                 

Gene name
FAS
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  
tumor necrosis factor receptor superfamily member 6
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
p53 signaling pathway
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    395274 (FAS)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    395274 (FAS)
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    395274 (FAS)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    395274 (FAS)
   05168 Herpes simplex infection
    395274 (FAS)
Cytokine receptors [BR:gga04050]
 TNF receptor family
  395274 (FAS)
Cellular antigens [BR:gga04090]
 Proteins
  395274 (FAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
6
AA seq 339 aa AA seqDB search
MARGLFHLLLVIVLVMETHCINDTEVPTHTAHNKSITRKRNIAKREITCGEGNYSFSGQC
CTKCKRGHVKSIDCPKTQAHCVPCKSGEEYMDHINDLDECMRCRSCDKALGLEVVKNCTS
TENAECSCAKNHYCNSSRCEHCESCTVCENGQIEKECTSTSDTVCRMQVKRKVNNYTTQG
NTAAADTGKVHSPETLRLIHIDVDLTHHVPDIVREMTLRQVITFVRHHRLSEPTIEETLL
DNSNNTSEQKIKLFQKWYQKHGMGGAYETLICSLRDLKMCTAADKIERKLKAAVSSHQER
RESYNDKTEQSNTCSQEGEKCYDDNAEISKTYPESLEET
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctcggggactcttccacctgctcctcgtcattgtgttagttatggaaacacactgc
ataaatgatacagaagttcccacacacactgcacataataaatctattacaaggaaaagg
aatattgctaagcgagaaattacctgtggagaggggaattacagtttcagtggtcagtgc
tgcacgaaatgtaaacgtggtcacgtcaaaagtattgactgtccaaaaactcaagcacat
tgtgtaccatgtaaatctggagaggagtacatggatcacatcaatgatttggacgagtgt
atgagatgtcgttcatgtgacaaagcactcggtttggaggttgtaaagaactgtacctct
acagagaatgcagaatgttcttgtgcaaagaaccattactgcaattcttctcggtgtgaa
cattgcgagtcatgtactgtatgtgaaaatggccaaattgaaaaggaatgtacttcaact
tcagacactgtgtgcagaatgcaagtcaagagaaaagtgaataattatactacccaaggt
aacacagctgcagcagacactggaaaagttcattctcctgagactttaagactcatacat
atagatgttgacctgacccaccacgtccctgacattgtgagggagatgacactacgtcag
gtcattacatttgttcgtcatcaccgtctatcggaacctaccatagaggaaactctcctg
gataacagcaataatacatctgaacagaagattaagctctttcagaaatggtaccaaaaa
catgggatgggaggagcctacgaaaccttaatatgcagcctgagagatttaaaaatgtgt
acagcagctgataaaattgagagaaaactgaaggcagctgtttccagccaccaggaaagg
agagaatcctataatgacaaaactgagcaaagcaatacctgcagtcaggaaggtgaaaaa
tgctacgatgataatgctgaaataagtaaaacctaccctgagagtttggaagagacatag

DBGET integrated database retrieval system