KEGG   Gallus gallus (chicken): 395274Help
Entry
395274            CDS       T01006                                 

Gene name
FAS
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  
tumor necrosis factor receptor superfamily member 6
Organism
gga  Gallus gallus (chicken)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
p53 signaling pathway
Apoptosis
Necroptosis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:gga00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    395274 (FAS)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    395274 (FAS)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    395274 (FAS)
   04217 Necroptosis
    395274 (FAS)
   04115 p53 signaling pathway
    395274 (FAS)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    395274 (FAS)
   05168 Herpes simplex infection
    395274 (FAS)
Cytokine receptors [BR:gga04050]
 TNF receptor family
  395274 (FAS)
CD molecules [BR:gga04090]
 Proteins
  395274 (FAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CGNC: 
Ensembl: 
Position
6
AA seq 339 aa AA seqDB search
MARGLFHLLLVIVLVMETHCINDTEVPTHTAHNKSITRKRNIAKREITCGEGNYSFSGQC
CTKCKRGHVKSIDCPKTQAHCVPCKSGEEYMDHINDLDECMRCRSCDKALGLEVVKNCTS
TENAECSCAKNHYCNSSRCEHCESCTVCENGQIEKECTSTSDTVCRMQVKRKVNNYTTQG
NTAAADTGKVHSPETLRLIHIDVDLTHHVPDIVREMTLRQVITFVRHHRLSEPTIEETLL
DNSNNTSEQKIKLFQKWYQKHGMGGAYETLICSLRDLKMCTAADKIERKLKAAVSSHQER
RESYNDKTEQSNTCSQEGEKCYDDNAEISKTYPESLEET
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctcggggactcttccacctgctcctcgtcattgtgttagttatggaaacacactgc
ataaatgatacagaagttcccacacacactgcacataataaatctattacaaggaaaagg
aatattgctaagcgagaaattacctgtggagaggggaattacagtttcagtggtcagtgc
tgcacgaaatgtaaacgtggtcacgtcaaaagtattgactgtccaaaaactcaagcacat
tgtgtaccatgtaaatctggagaggagtacatggatcacatcaatgatttggacgagtgt
atgagatgtcgttcatgtgacaaagcactcggtttggaggttgtaaagaactgtacctct
acagagaatgcagaatgttcttgtgcaaagaaccattactgcaattcttctcggtgtgaa
cattgcgagtcatgtactgtatgtgaaaatggccaaattgaaaaggaatgtacttcaact
tcagacactgtgtgcagaatgcaagtcaagagaaaagtgaataattatactacccaaggt
aacacagctgcagcagacactggaaaagttcattctcctgagactttaagactcatacat
atagatgttgacctgacccaccacgtccctgacattgtgagggagatgacactacgtcag
gtcattacatttgttcgtcatcaccgtctatcggaacctaccatagaggaaactctcctg
gataacagcaataatacatctgaacagaagattaagctctttcagaaatggtaccaaaaa
catgggatgggaggagcctacgaaaccttaatatgcagcctgagagatttaaaaatgtgt
acagcagctgataaaattgagagaaaactgaaggcagctgtttccagccaccaggaaagg
agagaatcctataatgacaaaactgagcaaagcaatacctgcagtcaggaaggtgaaaaa
tgctacgatgataatgctgaaataagtaaaacctaccctgagagtttggaagagacatag

DBGET integrated database retrieval system