KEGG   Gallus gallus (chicken): 395276Help
Entry
395276            CDS       T01006                                 

Gene name
CPA1
Definition
carboxypeptidase A1 (pancreatic) (EC:3.4.17.1)
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
gga  Gallus gallus (chicken)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
1
AA seq 419 aa AA seqDB search
MRALLLLAALGAVAAATTENFVGHQVLRIVPSSDAELQKVQELQELEHLQLDFWLSPRGL
GNPVDIRVPFPSLQPVKAHLEANGVPYSIMIEDVQALVDLEQMQMLRRRRFVPLSTSTFD
YTSYHTLEEIYAFMDLLVAENPNLVSKLEIGRTTENRPIYVLKFSKGGTNRPAIWIDTGI
HSREWVTQASGIWFAKKIVQEQDEGLANILDQMDIFLEIVTNPDGFAFTHTSNRMWRKTR
SKRSGSLCVGVDPNRNWDAGFGGSGASSNPCSETYHGPYANSEPEVKAIVDFVKSHKNIK
AFISIHSYSQLLLYPYGYTTTAVPDKEELHQVAKEAVAALSSLYGTNYKYGSIITTIYQA
SGGTIDWTYNQGIKYSFTFELRDTGRYGFLLPASQIVPTAQETWKALEVIMAHTRGHLY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagggcactcctactgctggctgccctgggggcagtggctgctgccaccactgagaat
tttgtcgggcaccaggtgctacgcatcgtccccagcagtgatgccgagctgcagaaggtg
caggagctgcaggagctggagcacctgcagctggatttctggctttcaccccgtggcctt
gggaacccagtcgacatccgtgtgcccttccccagcctgcagcccgtcaaagcccacctg
gaggccaatggtgtcccctactccatcatgattgaggacgtgcaggcgctggtggacctc
gaacagatgcagatgcttcgtcgccgccgtttcgtgccactttccaccagtacctttgac
tacaccagctaccacaccctggaggagatctatgccttcatggacctactggtggctgaa
aacccaaacctggtcagcaagctggagattggccgtacgacagagaaccgccccatctac
gtgttgaagttcagcaaaggtggcacgaatcgcccggccatttggattgacaccggcatc
cactcccgtgaatgggtgacacaagcaagcggcatttggttcgccaagaagattgtccaa
gagcaagatgaaggtctggccaacatcttggaccagatggacatcttcctggagattgtc
accaaccctgatggcttcgccttcacccacacctcgaatcgtatgtggcgcaagaccagg
tccaagcggtctggatccctctgcgttggcgttgaccccaaccgcaactgggacgcagga
tttggaggctctggggccagcagcaacccctgctcagagacgtaccacgggccctacgcc
aactcggagccagaggtgaaggccattgtggactttgtgaagagccataagaacatcaaa
gctttcatctccatccacagctactcccagcttctgctctacccctacggctacaccacc
accgctgtgcctgacaaggaggaactgcaccaggttgcgaaggaggctgtggcagctctg
tcctctctatatggcacgaattacaagtatggcagcatcatcaccaccatctatcaagca
agtggaggaaccatcgactggacctacaatcaaggcattaagtactccttcacctttgag
ctccgggacacgggacgctacgggttcctgctgcctgccagccagattgtccccactgct
caggagacatggaaagcactggaggtcatcatggcacatacacggggtcacctctactga

DBGET integrated database retrieval system