KEGG   Gallus gallus (chicken): 395280Help
Entry
395280            CDS       T01006                                 

Gene name
XIAP, BIRC4, IAP3
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
gga  Gallus gallus (chicken)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    395280 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    395280 (XIAP)
  Cellular commiunity
   04510 Focal adhesion
    395280 (XIAP)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    395280 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 493 aa AA seqDB search
MTCNGPDSSESGATPATDGDQEWTQEHYRLGTFVEFPHDCPVSASALARAGFVYTGEGDK
VKCFSCHVTVEGWEPGDSAIDRHKNLSPDCRFITGSAFLENNVHPLVQSHQHRTENGSSN
LALPSALEDLSDVEADYLLRTRQVVDMSDTLYPKNPAMCSEEARLKSFHNWPPYGLLTPK
ELASAGLYYTGVGDQVACFCCGGKLKNWEPGDRAWSEHKRHFPKCFFVLGRDVGNVSTDS
ICAELGRSCLNNEQHPRNPSMAEYERRIQTFLAWIYPVNKEHLAEAGFYSTGNGDHVVCF
HCGGGLQEWKENEDPWDQHAKWFPGCKFLRDEKGLEFINNVHLRDGCRDSTIEAAEVTIL
PKDDLLQNQLVQNAIHMGFSLSEIRSIMEKKLHLSGESYTSVEDLVADLISAQKENIKGE
PPKESPLEQDLSIEEKLRRLQEEKLCKICMAKDISVVLIPCGHLVACKECAEAVNKCPLC
CTNIIKRQKIFMY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacgtgtaatggcccagatagctctgaatctggtgccactccagccactgacggtgac
caggagtggacacaggaacactaccgactaggaacctttgtggagtttccccatgattgt
ccagtttcagcatcagcgctagctcgagctggctttgtttatactggagaaggtgataaa
gtcaagtgcttcagttgccatgtaactgttgaaggatgggagcctggggattctgcaatt
gacagacacaaaaacctttccccagattgcagatttattactgggtctgcttttttggaa
aataacgtacatcctcttgtgcagagccaccagcatagaactgaaaatggctccagcaat
ttggccctcccctctgctctggaggacttgtctgatgtggaggcagattacctgttgaga
accaggcaggttgtggacatgtccgatactttgtatcctaaaaaccctgctatgtgcagt
gaagaagccaggctgaagtcctttcacaattggcccccctatggcctattgacgccaaag
gaattagctagtgcaggactctactatacaggtgttggtgatcaagttgcatgtttctgt
tgcggtggaaaactgaaaaactgggaacctggtgatcgagcttggtctgagcacaagagg
cattttcccaaatgcttttttgtcctgggtcgggacgttggaaatgtttcaactgattct
atctgtgctgagcttgggagaagctgtctaaacaacgaacagcatccaaggaatccatcc
atggcagaatatgagaggcggatacaaacatttttagcttggatataccctgttaacaag
gaacatcttgctgaagcagggttctacagcacaggtaatggcgatcacgttgtgtgcttc
cactgtggtggaggattgcaagagtggaaggaaaatgaagacccatgggatcaacatgcc
aagtggtttcctgggtgcaagttcttgagagatgaaaagggactagaatttataaataat
gttcacttaagagatggatgtagggattcaacaatagaagctgctgaagttacaatactt
cctaaagatgacctcttacagaatcagttggtacagaatgccatacacatgggtttcagt
ttgtctgagattaggagcattatggaaaagaagttgcacctgtctggagaaagctacaca
tctgttgaagatctggtagcagacttaataagygctcagaaagaaaatataaagggagaa
ccaccaaaagaaagcccacttgagcaagatctcagtattgaagagaagttaagacgcttg
caggaagaaaagctctgtaaaatctgtatggctaaagacatatcagtagtcctcattccc
tgtggtcacctggttgcttgtaaggaatgtgctgaagcagttaataaatgtcctctgtgt
tgtacaaatattataaaaagacagaaaatttttatgtattag

DBGET integrated database retrieval system