KEGG   Gallus gallus (chicken): 395280Help
Entry
395280            CDS       T01006                                 

Gene name
XIAP, BIRC4, IAP3
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
gga  Gallus gallus (chicken)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:gga04120]
Cellular Processes; Cell growth and death; Apoptosis [PATH:gga04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:gga04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 493 aa AA seqDB search
MTCNGPDSSESGATPATDGDQEWTQEHYRLGTFVEFPHDCPVSASALARAGFVYTGEGDK
VKCFSCHVTVEGWEPGDSAIDRHKNLSPDCRFITGSAFLENNVHPLVQSHQHRTENGSSN
LALPSALEDLSDVEADYLLRTRQVVDMSDTLYPKNPAMCSEEARLKSFHNWPPYGLLTPK
ELASAGLYYTGVGDQVACFCCGGKLKNWEPGDRAWSEHKRHFPKCFFVLGRDVGNVSTDS
ICAELGRSCLNNEQHPRNPSMAEYERRIQTFLAWIYPVNKEHLAEAGFYSTGNGDHVVCF
HCGGGLQEWKENEDPWDQHAKWFPGCKFLRDEKGLEFINNVHLRDGCRDSTIEAAEVTIL
PKDDLLQNQLVQNAIHMGFSLSEIRSIMEKKLHLSGESYTSVEDLVADLISAQKENIKGE
PPKESPLEQDLSIEEKLRRLQEEKLCKICMAKDISVVLIPCGHLVACKECAEAVNKCPLC
CTNIIKRQKIFMY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacgtgtaatggcccagatagctctgaatctggtgccactccagccactgacggtgac
caggagtggacacaggaacactaccgactaggaacctttgtggagtttccccatgattgt
ccagtttcagcatcagcgctagctcgagctggctttgtttatactggagaaggtgataaa
gtcaagtgcttcagttgccatgtaactgttgaaggatgggagcctggggattctgcaatt
gacagacacaaaaacctttccccagattgcagatttattactgggtctgcttttttggaa
aataacgtacatcctcttgtgcagagccaccagcatagaactgaaaatggctccagcaat
ttggccctcccctctgctctggaggacttgtctgatgtggaggcagattacctgttgaga
accaggcaggttgtggacatgtccgatactttgtatcctaaaaaccctgctatgtgcagt
gaagaagccaggctgaagtcctttcacaattggcccccctatggcctattgacgccaaag
gaattagctagtgcaggactctactatacaggtgttggtgatcaagttgcatgtttctgt
tgcggtggaaaactgaaaaactgggaacctggtgatcgagcttggtctgagcacaagagg
cattttcccaaatgcttttttgtcctgggtcgggacgttggaaatgtttcaactgattct
atctgtgctgagcttgggagaagctgtctaaacaacgaacagcatccaaggaatccatcc
atggcagaatatgagaggcggatacaaacatttttagcttggatataccctgttaacaag
gaacatcttgctgaagcagggttctacagcacaggtaatggcgatcacgttgtgtgcttc
cactgtggtggaggattgcaagagtggaaggaaaatgaagacccatgggatcaacatgcc
aagtggtttcctgggtgcaagttcttgagagatgaaaagggactagaatttataaataat
gttcacttaagagatggatgtagggattcaacaatagaagctgctgaagttacaatactt
cctaaagatgacctcttacagaatcagttggtacagaatgccatacacatgggtttcagt
ttgtctgagattaggagcattatggaaaagaagttgcacctgtctggagaaagctacaca
tctgttgaagatctggtagcagacttaataagygctcagaaagaaaatataaagggagaa
ccaccaaaagaaagcccacttgagcaagatctcagtattgaagagaagttaagacgcttg
caggaagaaaagctctgtaaaatctgtatggctaaagacatatcagtagtcctcattccc
tgtggtcacctggttgcttgtaaggaatgtgctgaagcagttaataaatgtcctctgtgt
tgtacaaatattataaaaagacagaaaatttttatgtattag

DBGET integrated database retrieval system