KEGG   Gallus gallus (chicken): 395280Help
Entry
395280            CDS       T01006                                 

Gene name
XIAP, BIRC4, IAP3
Definition
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  
E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
gga  Gallus gallus (chicken)
Pathway
Ubiquitin mediated proteolysis
Focal adhesion
Brite
KEGG Orthology (KO) [BR:gga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    395280 (XIAP)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    395280 (XIAP)
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     395280 (XIAP)
Ubiquitin system [BR:gga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    395280 (XIAP)
Mitochondrial biogenesis [BR:gga03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    395280 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
UniProt: 
Position
4
AA seq 493 aa AA seqDB search
MTCNGPDSSESGATPATDGDQEWTQEHYRLGTFVEFPHDCPVSASALARAGFVYTGEGDK
VKCFSCHVTVEGWEPGDSAIDRHKNLSPDCRFITGSAFLENNVHPLVQSHQHRTENGSSN
LALPSALEDLSDVEADYLLRTRQVVDMSDTLYPKNPAMCSEEARLKSFHNWPPYGLLTPK
ELASAGLYYTGVGDQVACFCCGGKLKNWEPGDRAWSEHKRHFPKCFFVLGRDVGNVSTDS
ICAELGRSCLNNEQHPRNPSMAEYERRIQTFLAWIYPVNKEHLAEAGFYSTGNGDHVVCF
HCGGGLQEWKENEDPWDQHAKWFPGCKFLRDEKGLEFINNVHLRDGCRDSTIEAAEVTIL
PKDDLLQNQLVQNAIHMGFSLSEIRSIMEKKLHLSGESYTSVEDLVADLISAQKENIKGE
PPKESPLEQDLSIEEKLRRLQEEKLCKICMAKDISVVLIPCGHLVACKECAEAVNKCPLC
CTNIIKRQKIFMY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacgtgtaatggcccagatagctctgaatctggtgccactccagccactgacggtgac
caggagtggacacaggaacactaccgactaggaacctttgtggagtttccccatgattgt
ccagtttcagcatcagcgctagctcgagctggctttgtttatactggagaaggtgataaa
gtcaagtgcttcagttgccatgtaactgttgaaggatgggagcctggggattctgcaatt
gacagacacaaaaacctttccccagattgcagatttattactgggtctgcttttttggaa
aataacgtacatcctcttgtgcagagccaccagcatagaactgaaaatggctccagcaat
ttggccctcccctctgctctggaggacttgtctgatgtggaggcagattacctgttgaga
accaggcaggttgtggacatgtccgatactttgtatcctaaaaaccctgctatgtgcagt
gaagaagccaggctgaagtcctttcacaattggcccccctatggcctattgacgccaaag
gaattagctagtgcaggactctactatacaggtgttggtgatcaagttgcatgtttctgt
tgcggtggaaaactgaaaaactgggaacctggtgatcgagcttggtctgagcacaagagg
cattttcccaaatgcttttttgtcctgggtcgggacgttggaaatgtttcaactgattct
atctgtgctgagcttgggagaagctgtctaaacaacgaacagcatccaaggaatccatcc
atggcagaatatgagaggcggatacaaacatttttagcttggatataccctgttaacaag
gaacatcttgctgaagcagggttctacagcacaggtaatggcgatcacgttgtgtgcttc
cactgtggtggaggattgcaagagtggaaggaaaatgaagacccatgggatcaacatgcc
aagtggtttcctgggtgcaagttcttgagagatgaaaagggactagaatttataaataat
gttcacttaagagatggatgtagggattcaacaatagaagctgctgaagttacaatactt
cctaaagatgacctcttacagaatcagttggtacagaatgccatacacatgggtttcagt
ttgtctgagattaggagcattatggaaaagaagttgcacctgtctggagaaagctacaca
tctgttgaagatctggtagcagacttaataagtgctcagaaagaaaatataaagggagaa
ccaccaaaagaaagcccacttgagcaagatctcagtattgaagagaagttaagacgcttg
caggaagaaaagctctgtaaaatctgtatggctaaagacatatcagtagtcctcattccc
tgtggtcacctggttgcttgtaaggaatgtgctgaagcagttaataaatgtcctctgtgt
tgtacaaatattataaaaagacagaaaatttttatgtattag

DBGET integrated database retrieval system