KEGG   Gallus gallus (chicken): 395413Help
Entry
395413            CDS       T01006                                 

Gene name
KAT5
Definition
K(lysine) acetyltransferase 5
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     395413 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CGNC: 
UniProt: 
Position
Un
AA seq 231 aa AA seqDB search
MTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTALPVLYLCEFCLKYGH
SLRCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYY
DTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYE
LSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKAEGGERPQITIK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcagcctggtgtcggaccgcagccacgacgacatcgtcaccaggatgaagaac
atcgaatgcatcgagctgggcaggcaccgcctcaagccctggtatttctcaccctacccc
caggagctgacggctctgcccgtcctctacctctgtgagttctgcctcaagtacggccac
agcctgcgctgcctccagaggcatttgaccaaatgtgacctccggcaccccccgggcaat
gaaatctatcgcaaaggcaccatttcctttttcgagatcgatggccgcaaaaacaagagt
tactcacagaacctgtgcctgttggccaagtgcttcctggaccacaaaacactttactac
gacaccgatcctttcctcttctatgtcatgactgagtacgactgcaagggcttccacatc
gttggctatttctccaaggagaaagaatcgacagaggattacaacgtggcgtgcatcctg
acactgcccccctaccagcgtcggggttatggcaagctgctcatcgagttcagttatgag
ctgtccaaagtggaggggaagacggggacccccgagaagccactgtcagacctggggctg
ctgtcgtaccgcagctattggtcacaaaccatcctggagatcctgatggggctgaaggct
gaggggggggagcgaccccagatcaccatcaagtaa

DBGET integrated database retrieval system