KEGG   Gallus gallus (chicken): 395413Help
Entry
395413            CDS       T01006                                 

Gene name
KAT5, Tip60
Definition
(RefSeq) lysine acetyltransferase 5
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
gga  Gallus gallus (chicken)
Brite
Enzymes [BR:gga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     395413 (KAT5)
Chromosome [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    395413 (KAT5)
   HAT complexes
    TIP60 complex
     395413 (KAT5)
    NuA4 complex
     395413 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
CGNC: 
Ensembl: 
Position
Un
AA seq 628 aa AA seqDB search
MMAAVGDGGGVGGAGGALRAPPPPPPVQSRRFRKCRRHVSKAAGKATPLPPYGSAASALR
SAMRMRNRKRAEKGRKWVEREEEALWAPSGSGALHPEAACGEMAEAAEVSEGCRLPVLRR
NQDNEDEWPLAEILSVKDISGRRLFYVHYIDFNKRLDEWVTPERLDLQRVQGPRKEAKTP
TKNGLPGSRPDSPERDPRKSLELALAPASGKSLPGPPGPPGPPGPPGPAGLGPGPLPLTL
RFHLPQDSVAEPPPAPQRPTKRKVEVVSPATPVPAATETSQASVFPQNGSARRAVAAQPG
RKRKSACLGTDEDSQDSSDGAPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPW
YFSPYPQELTALPVLYLCEFCLKYGHSLRCLQRHLTKCDLRHPPGNEIYRKGTISFFEID
GRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDY
NVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEI
LMGLKAEGGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSGDIVEGHE
RAMLKRVLRIDAKCLHFTPKDWSKRGKW
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggcggtgggagatgggggaggggtgggcggggccgggggcgctctccgcgct
cctccgccaccgccgcccgtgcagagccgccgcttccggaagtgccgccgtcacgtgagc
aaggctgccgggaaggccacgcctcttccgccttatggcagcgcggcctccgccctgcgt
tcggctatgcgcatgcgcaatcggaagcgggcggagaaggggcggaagtgggtggagcgc
gaggaggaagcgctctgggcgccgagcggaagtggcgcactgcacccggaagcggcctgc
ggggagatggcggaggcggccgaggtgtcggagggctgccgcctgcccgtgctgcgccgt
aaccaggacaacgaggatgagtggccgttggccgagatcctgagcgtgaaggacatcagc
ggccgccgcctcttctacgtccattatatcgactttaataaacgtctggacgaatgggtg
acccccgaacgcctggacctgcagcgggtgcagggaccccgcaaagaagccaagaccccc
accaagaacggcctgcccggctcccggcccgactcacccgaacgtgacccgaggaagagt
ctggagctggcgctggcccccgccagcgggaagagcctgccagggccaccggggccacca
gggccaccagggccaccggggccagcggggttggggccggggccgctgcccctcaccctc
cgcttccatctgccccaggacagcgtggccgagccccccccggccccgcagcgtcccacg
aagcgtaaagtggaggtggtctcacctgccacccccgtccccgcggccaccgaaacctcg
caggcatccgtcttcccccagaacggctcagcacgccgcgccgtggccgcccaaccgggg
cgtaagaggaaatcagcgtgcctggggactgatgaggactcccaggactcctcggatggt
gctccctctgccccccgcatgacgggcagcctggtgtcggaccgcagccacgacgacatc
gtcaccaggatgaagaacatcgaatgcatcgagctgggcaggcaccgcctcaagccctgg
tatttctcaccctacccccaggagctgacggctctgcccgtcctctacctctgtgagttc
tgcctcaagtacggccacagcctgcgctgcctccagaggcatttgaccaaatgtgacctc
cggcaccccccgggcaatgaaatctatcgcaaaggcaccatttcctttttcgagatcgat
ggccgcaaaaacaagagttactcacagaacctgtgcctgttggccaagtgcttcctggac
cacaaaacactttactacgacaccgatcctttcctcttctatgtcatgactgagtacgac
tgcaagggcttccacatcgttggctatttctccaaggagaaagaatcgacagaggattac
aacgtggcgtgcatcctgacactgcccccctaccagcgtcggggttatggcaagctgctc
atcgagttcagttatgagctgtccaaagtggaggggaagacggggacccccgagaagcca
ctgtcagacctggggctgctgtcgtaccgcagctattggtcacaaaccatcctggagatc
ctgatggggctgaaggctgaggggggggagcgaccccagatcaccatcaatgagatcagc
gagatcaccagcatcaaaaaggaggacgttatctccacgctgcagtacctcaacctcatc
aactactacaagggccaatacatcctgacgctgtcgggggacatcgtggagggccacgag
cgcgccatgctgaagcgggtgctgcgcatcgacgccaagtgcctccatttcacccccaag
gactggagcaagaggggcaagtggtga

DBGET integrated database retrieval system